DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and CG9344

DIOPT Version :10

Sequence 1:NP_001304094.1 Gene:SNRPG / 6637 HGNCID:11163 Length:96 Species:Homo sapiens
Sequence 2:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster


Alignment Length:54 Identity:14/54 - (25%)
Similarity:29/54 - (53%) Gaps:4/54 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     9 LKKFMD----KKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIG 58
            |.:|::    :.:::|||.|...:|:|...|.:||:.:::..|......:|..|
  Fly     7 LSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYG 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001304094.1 Sm_G 5..>60 CDD:212466 14/54 (26%)
CG9344NP_611528.1 LSm6 8..73 CDD:212473 13/53 (25%)

Return to query results.
Submit another query.