DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and SmF

DIOPT Version :10

Sequence 1:NP_001304094.1 Gene:SNRPG / 6637 HGNCID:11163 Length:96 Species:Homo sapiens
Sequence 2:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster


Alignment Length:89 Identity:23/89 - (25%)
Similarity:45/89 - (50%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSKAHPPELKKFMD----KKLSLKLNGGRHVQGILRGFDPFMNLVI---DECVEMATSGQQNNIG 58
            ||...|...|.|::    |.:.:||..|:..:|.|...|.:||:.:   :|.:|.:.:|   |:|
  Fly     1 MSAGMPINPKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTG---NLG 62

Human    59 MVDNIPNKAVSPKFLKKVNQKGQL 82
            .|....|..:..|.::..:::|::
  Fly    63 EVLIRCNNVLYIKGMEDDDEEGEM 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001304094.1 Sm_G 5..>60 CDD:212466 17/61 (28%)
SmFNP_523708.2 Sm_F 8..76 CDD:212469 18/70 (26%)

Return to query results.
Submit another query.