DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPG and SmE

DIOPT Version :10

Sequence 1:NP_001304094.1 Gene:SNRPG / 6637 HGNCID:11163 Length:96 Species:Homo sapiens
Sequence 2:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster


Alignment Length:83 Identity:23/83 - (27%)
Similarity:40/83 - (48%) Gaps:20/83 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSKAHPPELKKFMDKKLSLKL---------------NGGRHVQGILRGFDPFMNLVIDECVEM-A 49
            ||....|:::|.|.:.::|..               |....::|.:.|||.:||||:|:..|: .
  Fly     1 MSFKGNPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYV 65

Human    50 TSGQQNNIGMV----DNI 63
            .:.|:.|:|.:    |||
  Fly    66 KTRQRRNLGRIMLKGDNI 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPGNP_001304094.1 Sm_G 5..>60 CDD:212466 18/70 (26%)
SmENP_609162.1 Sm_E 10..88 CDD:212465 20/74 (27%)

Return to query results.
Submit another query.