DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPB and CG2021

DIOPT Version :10

Sequence 1:NP_937859.1 Gene:SNRPB / 6628 HGNCID:11153 Length:240 Species:Homo sapiens
Sequence 2:NP_647660.1 Gene:CG2021 / 38229 FlyBaseID:FBgn0035271 Length:95 Species:Drosophila melanogaster


Alignment Length:103 Identity:32/103 - (31%)
Similarity:52/103 - (50%) Gaps:20/103 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     7 SKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVL 71
            |.:..:|::.:..|..|||.||||.|.||:.:|:|:.:|.|      :........|:.||||.:
  Fly     2 SGLESYINHTVSIITADGRNFIGTLKGFDQTINIIIDECHE------RVFSTTSGIEQIVLGLHI 60

Human    72 LRGEN-----LVSMTVEGPPPKDTGIARVPLAGAAGGP 104
            :||:|     |:..|::         :|:.||...|.|
  Fly    61 IRGDNIAVIGLIDETID---------SRLDLANIRGEP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPBNP_937859.1 Sm_B 5..83 CDD:212464 27/80 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..240
Repeat-rich region 175..236
CG2021NP_647660.1 LSm8 1..91 CDD:212474 32/103 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.