DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPA1 and CG31274

DIOPT Version :10

Sequence 1:NP_003081.2 Gene:SNRPA1 / 6627 HGNCID:11152 Length:255 Species:Homo sapiens
Sequence 2:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster


Alignment Length:196 Identity:45/196 - (22%)
Similarity:75/196 - (38%) Gaps:54/196 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    42 DQFDA----IDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLD----QALPCLTELILTNN 98
            |:|.|    :|.|.|:.|.|........|.||:::.|      ..||    ..||.|..|.:.|.
  Fly   105 DKFAAQTKFLDLSHNDFRNLRFLSFFEDLDTLILDRN------VNLDINTFPYLPSLRILWINNC 163

Human    99 SLVELGD----LDPLASLKSLTYLSILRNP----VTNKKHYRLYVIYKVPQVRVLDFQKVKLKER 155
            .:..:.|    ::  ....:|..||.:.||    |...:..|.|::..:||::.||         
  Fly   164 DIANITDWIHRIE--RHCPALDQLSCMGNPGIRTVFGGQGPREYILQVLPQLKYLD--------- 217

Human   156 QEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERL 220
                       |...:::.|.        |.|.:.:.:|..|..:.|  |..:|:|.|..::.|.
  Fly   218 -----------GLPTSRNAAY--------ATLSSSQGQGPDSTSNSE--KPPLASAFTFKDIIRP 261

Human   221 K 221
            |
  Fly   262 K 262

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SNRPA1NP_003081.2 LRR_9 1..175 CDD:405295 33/148 (22%)
LRR 1 20..41