DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPA and snrpa

DIOPT Version :9

Sequence 1:NP_004587.1 Gene:SNRPA / 6626 HGNCID:11151 Length:282 Species:Homo sapiens
Sequence 2:NP_001016784.1 Gene:snrpa / 549538 XenbaseID:XB-GENE-494246 Length:282 Species:Xenopus tropicalis


Alignment Length:286 Identity:236/286 - (82%)
Similarity:251/286 - (87%) Gaps:8/286 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSA 65
            |||.|.|||:|||||||||||||||||||||||||||||||||||||||||||||||||||:|||
 Frog     1 MAVQEVRPNNTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEISSA 65

Human    66 TNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKR-EKRKPKSQETPATKKAVQGGG 129
            |||||||||||||||||||||:|:|||||||||||:||||||| ||||.|.||.|..|||:.|..
 Frog    66 TNALRSMQGFPFYDKPMRIQYSKSDSDIIAKMKGTYVERDRKRQEKRKVKGQEAPGVKKALPGAA 130

Human   130 ATPVVGAVQGPVPGM---PPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLM 191
            ..|   .|.|.:.||   |.||||||:| ||.||.|||..|||:||||:||||||||.||...||
 Frog   131 LLP---GVPGQMAGMQNIPGMTQAPRMM-HMAGQAPYMHHPGMMPPPGMAPGQIPPGGMPHGHLM 191

Human   192 PGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQ 256
            ||||.|.||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog   192 PGQMAPMQPISENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQ 256

Human   257 AGAARDALQGFKITQNNAMKISFAKK 282
            |||||::||||||||:|:||||||||
 Frog   257 AGAARESLQGFKITQSNSMKISFAKK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPANP_004587.1 RRM1_U1A 7..95 CDD:409906 83/87 (95%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..132 20/32 (63%)
RRM2_U1A 197..282 CDD:409908 78/84 (93%)
snrpaNP_001016784.1 RRM1_U1A 7..95 CDD:240921 83/87 (95%)
PABP-1234 <10..205 CDD:130689 154/198 (78%)
RRM2_U1A 203..282 CDD:240924 74/78 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I18311
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3380
Inparanoid 1 1.050 461 1.000 Inparanoid score I8246
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG54412
OrthoDB 1 1.010 - - D1608132at2759
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 1 1.000 - - oto152067
Panther 1 1.100 - - LDO PTHR10501
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.080

Return to query results.
Submit another query.