DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRPA and snf

DIOPT Version :9

Sequence 1:NP_004587.1 Gene:SNRPA / 6626 HGNCID:11151 Length:282 Species:Homo sapiens
Sequence 2:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster


Alignment Length:286 Identity:156/286 - (54%)
Similarity:179/286 - (62%) Gaps:79/286 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     5 ETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNAL 69
            |..||.|||||||||||||:|||||||||||||||||||:..::|||||||||||||:.||:|||
  Fly     2 EMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNAL 66

Human    70 RSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVV 134
            |:|||||||||||:|.|:|:||||:||:||||.||.:|                           
  Fly    67 RTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKK--------------------------- 104

Human   135 GAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPG--------QIPPGAMPPQQLM 191
                                               :.||..|||        :.|..|       
  Fly   105 -----------------------------------VKPPKPAPGTDEKKDKKKKPSSA------- 127

Human   192 PGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQ 256
            ....|.||  :|.|||.|||||||||||||:|||||||||||||||||||.|||||||||..|:|
  Fly   128 ENSNPNAQ--TEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQ 190

Human   257 AGAARDALQGFKITQNNAMKISFAKK 282
            :.||::||||||||..:||||:||||
  Fly   191 SNAAKEALQGFKITPTHAMKITFAKK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRPANP_004587.1 RRM1_U1A 7..95 CDD:409906 71/87 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..132 5/31 (16%)
RRM2_U1A 197..282 CDD:409908 65/84 (77%)
snfNP_511045.1 RRM <5..177 CDD:223796 126/242 (52%)
RRM_SF 6..96 CDD:302621 72/89 (81%)
RRM2_SNF 137..216 CDD:240923 63/78 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5403
eggNOG 1 0.900 - - E1_KOG4206
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3380
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S1235
OMA 1 1.010 - - QHG54412
OrthoDB 1 1.010 - - D1608132at2759
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 1 1.000 - - otm41837
orthoMCL 1 0.900 - - OOG6_100753
Panther 1 1.100 - - LDO PTHR10501
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1270
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.