DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BNIP1 and Sec20

DIOPT Version :9

Sequence 1:NP_053582.2 Gene:BNIP1 / 662 HGNCID:1082 Length:271 Species:Homo sapiens
Sequence 2:NP_001287187.1 Gene:Sec20 / 40724 FlyBaseID:FBgn0037383 Length:227 Species:Drosophila melanogaster


Alignment Length:262 Identity:76/262 - (29%)
Similarity:128/262 - (48%) Gaps:54/262 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    14 QEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQPVLYQRAFIWTASTFFFKL 78
            |:::..:|:.||:|.||.:....::.|.|||...:.|...:|..|:                   
  Fly    13 QDLIDNNLQAKAIIHDILNSRTSIAELEELNEAGRSKLSAIRKSIE------------------- 58

Human    79 TYSLTDFSSTQHDFNSPTTPVTFSDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANL 143
              .|.|::                          :::....|..||::|:.|......::||||:
  Fly    59 --RLDDWA--------------------------RDTADSALANEVDDHRDQFSKTLQAFRKANV 95

Human   144 TCKIAIDNLEKAEL--LQGGDLLRQRKTTKE-----SLAQTSSTITESLMGISRMMAQQVQQSEE 201
            :..:.|:...:.||  :.|...||||.||:.     ||....:.:||.::.|||.:::..|:|..
  Fly    96 STMLEIEKANREELMAITGESELRQRTTTRARHNQGSLVSQENDVTEKMLAISRHLSETTQKSAI 160

Human   202 AMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKR 266
            .:::||.||:.:...::|....:|:|.:..||:.||.|||.|||:|:|.|.:||||.|.|||:||
  Fly   161 TLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRECTDKMLLFFAFSLFLACVFYIVQKR 225

Human   267 LF 268
            ||
  Fly   226 LF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BNIP1NP_053582.2 SNARE_SEC20 175..267 CDD:277218 36/91 (40%)
Sec20NP_001287187.1 Sec20 135..226 CDD:112708 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160378
Domainoid 1 1.000 81 1.000 Domainoid score I8593
eggNOG 1 0.900 - - E1_28N8I
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H930
Inparanoid 1 1.050 132 1.000 Inparanoid score I4619
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55915
OrthoDB 1 1.010 - - D1328108at2759
OrthoFinder 1 1.000 - - FOG0004333
OrthoInspector 1 1.000 - - oto91820
orthoMCL 1 0.900 - - OOG6_103788
Panther 1 1.100 - - LDO PTHR12825
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3048
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.