DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eef1e1 and GstE9

DIOPT Version :9

Sequence 1:NP_079656.1 Gene:Eef1e1 / 66143 MGIID:1913393 Length:174 Species:Mus musculus
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:171 Identity:35/171 - (20%)
Similarity:70/171 - (40%) Gaps:25/171 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 ELRLLEKSLGLKPGNKYSAQG-ERQIPVLQTNNGPSLMGLSTIATHLVKQ-ASKEHLLGSTAEEK 68
            |.||:....|.....::|.:. :..:|||: ::|..:.....|..:||:: |..:.|......::
  Fly    30 EYRLVNLLAGEHKTKEFSLKNPQHTVPVLE-DDGKFIWESHAICAYLVRRYAKSDDLYPKDYFKR 93

Mouse    69 AMVQQWLEF--------------------RVTRVDGHSSKEDTQTLLKDLNSYLEDKVYLAGHNI 113
            |:|.|.|.|                    .:|.|. .|..:........|.:::.::.||.|..|
  Fly    94 ALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVP-RSQIDAIYEAYDFLEAFIGNQAYLCGPVI 157

Mouse   114 TLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPD 154
            |:||..:...:.. :|.|...:.::|..::.|...:...|:
  Fly   158 TIADYSVVSSVSS-LVGLAAIDAKRYPKLNGWLDRMAAQPN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eef1e1NP_079656.1 N-terminal. /evidence=ECO:0000250 2..56 12/51 (24%)
Linker. /evidence=ECO:0000250 57..63 1/5 (20%)
C-terminal. /evidence=ECO:0000250 64..152 20/107 (19%)
GST_C_AIMP3 65..165 CDD:198338 21/110 (19%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 35/171 (20%)
GST_N_Delta_Epsilon 4..76 CDD:239343 10/46 (22%)
GST_C_Delta_Epsilon 92..209 CDD:198287 21/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.