DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SUMO3 and Rad60

DIOPT Version :10

Sequence 1:NP_001273345.1 Gene:SUMO3 / 6612 HGNCID:11124 Length:141 Species:Homo sapiens
Sequence 2:NP_651134.1 Gene:Rad60 / 42748 FlyBaseID:FBgn0039065 Length:424 Species:Drosophila melanogaster


Alignment Length:31 Identity:12/31 - (38%)
Similarity:18/31 - (58%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    93 RQIRFRFDGQPINETDTPAQLEMEDEDTIDV 123
            |.|:..|||..::..|||...:||..:.||:
  Fly   390 RTIKLFFDGDLLDPNDTPNNQDMEGNEVIDL 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SUMO3NP_001273345.1 Ubl_SUMO2_3_4 16..125 CDD:340532 12/31 (39%)
Rad60NP_651134.1 Ubl1_cv_Nsp3_N-like 254..315 CDD:475130
Ubl_SUMO_like 350..419 CDD:340462 10/28 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.