DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SUMO3 and smt3

DIOPT Version :9

Sequence 1:NP_001273345.1 Gene:SUMO3 / 6612 HGNCID:11124 Length:141 Species:Homo sapiens
Sequence 2:NP_001303312.1 Gene:smt3 / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster


Alignment Length:132 Identity:67/132 - (50%)
Similarity:77/132 - (58%) Gaps:42/132 - (31%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQVRHLAPPQSLPVCAL 65
            ||:|| |.|   |.:||||||.|||.:|||||||:||||.|||.|||:|                
  Fly     1 MSDEK-KGG---ETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDR---------------- 45

Human    66 VLCVPGIPRARASRGWTQMQLPEGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 130
                                  .||||:.:|||||||||||.|||..||||:.|||:|:||||||
  Fly    46 ----------------------AGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGG 88

Human   131 VP 132
            .|
  Fly    89 AP 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SUMO3NP_001273345.1 Sumo 7..130 CDD:176359 60/122 (49%)
UBQ 17..123 CDD:214563 51/105 (49%)
smt3NP_001303312.1 Ubl_SUMO2_3_4 12..83 CDD:340532 53/108 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147517
Domainoid 1 1.000 112 1.000 Domainoid score I6198
eggNOG 1 0.900 - - E1_COG5227
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38251
Inparanoid 1 1.050 135 1.000 Inparanoid score I4583
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54171
OrthoDB 1 1.010 - - D1583700at2759
OrthoFinder 1 1.000 - - FOG0000413
OrthoInspector 1 1.000 - - otm42303
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10562
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2296
SonicParanoid 1 1.000 - - X327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.