DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SUMO3 and CG43069

DIOPT Version :10

Sequence 1:NP_001273345.1 Gene:SUMO3 / 6612 HGNCID:11124 Length:141 Species:Homo sapiens
Sequence 2:NP_001246412.1 Gene:CG43069 / 12798338 FlyBaseID:FBgn0262479 Length:79 Species:Drosophila melanogaster


Alignment Length:39 Identity:11/39 - (28%)
Similarity:19/39 - (48%) Gaps:6/39 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   218 RIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK 256
            |:|.:.|..::..||..::|...|...:|      |:||
  Fly   132 RLAQAWRGFMVYWAEREEMFFARPYGAIN------LRRK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SUMO3NP_001273345.1 Ubl_SUMO2_3_4 16..125 CDD:340532
CG43069NP_001246412.1 Ubl_SUMO_like 7..76 CDD:340462
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.