DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMARCD3 and Non2

DIOPT Version :9

Sequence 1:XP_024302654.1 Gene:SMARCD3 / 6604 HGNCID:11108 Length:525 Species:Homo sapiens
Sequence 2:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster


Alignment Length:258 Identity:43/258 - (16%)
Similarity:80/258 - (31%) Gaps:98/258 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    64 GMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRRKMADKILPQRIRELVPESQAYMDLLAF 128
            |.:|    .|.|..:|:...:..|   :.:...:||::|.:.|..||..:...|           
  Fly    71 GKDP----DADPDDESEPSEEEDP---SSSEEEAAKKKKQSPKKRPQPTKHKAP----------- 117

Human   129 ERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIASWELRVEGKLLDD 193
                                   |:|||       |.|......|...||.:.:|:     :...
  Fly   118 -----------------------KKKRK-------TLNADDSGTESDAGSDSDYEV-----VKKP 147

Human   194 PSKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDLSVRCTLLLMLDY 258
            .:|:|.|.:.                        .|.:.:::.||                    
  Fly   148 AAKKKAKAAG------------------------GTGSGRKSTGF-------------------- 168

Human   259 QPPQFKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLK 321
             ...:.|.|.|:.|:|..:..|..:|:.:|..:|...|.|..:|::...|....::....|.:
  Fly   169 -TRAYNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDDELMKVMKIRRFR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMARCD3XP_024302654.1 Cytadhesin_P30 <27..67 CDD:284643 1/2 (50%)
DUF4106 <28..>138 CDD:315952 13/73 (18%)
SWIB 259..335 CDD:128456 14/63 (22%)
Non2NP_647745.1 DEK_C 7..57 CDD:285919
SWIB 170..242 CDD:280380 14/61 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149691
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.