DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BOLL and Ref1

DIOPT Version :10

Sequence 1:XP_047301536.1 Gene:BOLL / 66037 HGNCID:14273 Length:345 Species:Homo sapiens
Sequence 2:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster


Alignment Length:109 Identity:28/109 - (25%)
Similarity:55/109 - (50%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    37 PRYGTV----IPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQED 97
            |:.|.|    .|.|:.||.:|:..:.:|:::.|:.:|.:|:..:..||:|.|.|...|.||.:.|
  Fly    97 PKRGAVGGGSGPTRLIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRAD 161

Human    98 AQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIM--PAAGT 139
            |.|.:::...:....:.:.|       |:.:...:::  |.|.|
  Fly   162 ALKAIKQYHGVPLDGRPMTI-------QLAVSDVAVLTRPVAAT 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BOLLXP_047301536.1 RRM_BOULE 43..123 CDD:410074 21/79 (27%)
PRK10263 <124..>309 CDD:236669 4/18 (22%)
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 25/93 (27%)
RRM_THOC4 109..183 CDD:410081 20/80 (25%)
FoP_duplication 202..>260 CDD:464005
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.