DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BOLL and x16

DIOPT Version :10

Sequence 1:XP_047301536.1 Gene:BOLL / 66037 HGNCID:14273 Length:345 Species:Homo sapiens
Sequence 2:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster


Alignment Length:53 Identity:17/53 - (32%)
Similarity:28/53 - (52%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    46 RIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDA 98
            :::||.:.....::||...|..|||::.|.|..:    ..|:.||.||:..||
  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARN----PPGFAFVEFESARDA 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BOLLXP_047301536.1 RRM_BOULE 43..123 CDD:410074 17/53 (32%)
PRK10263 <124..>309 CDD:236669
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.