DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMARCD1 and Non2

DIOPT Version :9

Sequence 1:NP_003067.3 Gene:SMARCD1 / 6602 HGNCID:11106 Length:515 Species:Homo sapiens
Sequence 2:NP_647745.1 Gene:Non2 / 38341 FlyBaseID:FBgn0035370 Length:244 Species:Drosophila melanogaster


Alignment Length:272 Identity:51/272 - (18%)
Similarity:85/272 - (31%) Gaps:112/272 - (41%)


- Green bases have known domain annotations that are detailed below.


Human    82 GGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQA 146
            |.:|...|.      |:|.    |.:    ::....:....|||||.:.|..||..:...|    
  Fly    71 GKDPDADPD------DESE----PSE----EEDPSSSEEEAAKKKKQSPKKRPQPTKHKAP---- 117

Human   147 YMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRV 211
                                          |:|||       |.|...|..|...|:.:.:|   
  Fly   118 ------------------------------KKKRK-------TLNADDSGTESDAGSDSDYE--- 142

Human   212 EGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPG 276
                     :.|..|.|:|.|.:.                        .|.:.:::.||      
  Fly   143 ---------VVKKPAAKKKAKAAG------------------------GTGSGRKSTGF------ 168

Human   277 DVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDK 341
                           ...:.|.|.|:.|:|..:..|..:::.:|..||...|.||..::|.|||.
  Fly   169 ---------------TRAYNLSPELSALMGESSLPRHEVVKKVWAIIKERDLYDPKNKQFAICDD 218

Human   342 YLQQIFESQRMK 353
            .|.::.:.:|.:
  Fly   219 ELMKVMKIRRFR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMARCD1NP_003067.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..103 5/20 (25%)
Interaction with ESR1, NR1H4, NR3C1, PGR and SMARCA4. /evidence=ECO:0000269|PubMed:12917342 43..167 15/84 (18%)
Interaction with SMARCC1 and SMARCC2. /evidence=ECO:0000269|PubMed:12917342 168..474 36/186 (19%)
Necessary for GR/NR3C1-mediated remodeling and transcription from chromatin, required for GR/NR3C1 interaction with the BRG1/SMARCA4 complex in vivo 180..515 34/174 (20%)
SWIB_BAF60A 294..370 CDD:349493 18/60 (30%)
Non2NP_647745.1 DEK_C 7..57 CDD:285919
SWIB 170..242 CDD:280380 18/61 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.