DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMX and Btk29A

DIOPT Version :9

Sequence 1:NP_001712.1 Gene:BMX / 660 HGNCID:1079 Length:675 Species:Homo sapiens
Sequence 2:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster


Alignment Length:771 Identity:284/771 - (36%)
Similarity:407/771 - (52%) Gaps:156/771 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    11 LLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKIRCVEK--VNLEEQTP 73
            ::||:|.||:.:|.|||.|.|.|||...||::.:.::|...:|.|.:|.:|.||:  |:.|...|
  Fly    48 MVKRAQNKKRFTPVNYKHRWFELTKRTFSYFDVENVERRRERGRIHLKGVRLVEEATVSGEGGDP 112

Human    74 VERQ-YPFQIVY------------KDG---------------------LLYVYASNEESRSQWLK 104
            .... ||||:.|            ::|                     .|||.|::|:.||:|::
  Fly   113 FAPDGYPFQVGYCEISASANSHQLENGNGGGSGVGIEGQQSGRAVPQYTLYVIANSEKERSEWIR 177

Human   105 ALQKEIR-GNPHLLVKYHSGFFVDGKFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPD 168
            |:::... .|.....:||.|.:...|:.||:...:...||   .|.|:...|.|...:......:
  Fly   178 AIRQVCEDSNTPKSYRYHPGLWSGKKWSCCKGLSRTTFGC---RAAAHWREANNNPSNGSSPAQN 239

Human   169 RVLKIPRAVPVLKMDAPSSSTTLAQY--DNESKKNYGS--------------------------- 204
            ....|          :|:||||.:|:  .:.|..:.|.                           
  Fly   240 STRSI----------SPNSSTTNSQFSLQHNSSGSLGGGVGGGLGGGGSLGLGGGGGGGGSCTPT 294

Human   205 --QPPSSSTSLAQ-----------YDSNS------------------------------KKIYGS 226
              ||.||.|:..|           .|:|.                              |.|.|.
  Fly   295 SLQPQSSLTTFKQSPTLLNGNGTLLDANMPGGIPTPGTPNSKAKDNSHFVKLVVALYPFKAIEGG 359

Human   227 QPNF--NMQYIPREDFPD-WWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFPESSSSEEE 288
            ..:.  |.:|...:|..: ||:|:....               ||.:..|  ::..|::..    
  Fly   360 DLSLEKNAEYEVIDDSQEHWWKVKDALG---------------NVGYIPS--NYVKPKALL---- 403

Human   289 ENLDDYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHT 353
             .|:.|:|:.|::||.::|.||:|..|||.|:||.||..|:||:||.:|.   .:..|||||:..
  Fly   404 -GLERYEWYVGDMSRQRAESLLKQGDKEGCFVVRKSSTKGLYTLSLHTKV---PQSHVKHYHIKQ 464

Human   354 NAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANK-VPDSVSLGNGIWELKREEI 417
            ||..:.||:|.:|.::||.||:||:|||.|:..||:   |:..:: ||.:..|.:..||:...|:
  Fly   465 NARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLK---SSPCDRPVPPTAGLSHDKWEIHPMEL 526

Human   418 TLLKELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKE 482
            .|::||||||||||:.|||:|..|.||||:|||:||||:|.:||:.|.||.||.||:.||||||.
  Fly   527 MLMEELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKH 591

Human   483 YPIYIVTEYISNGCLLNYLRSHGKGL--EPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVD 545
            .||||||||:.:|.||||||.|.|.|  ....||:||..|.:||.:||.|.:||||||||||||.
  Fly   592 RPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVG 656

Human   546 RDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGK 610
            .:..|||:|||:.||||||||.||.|||||:||:.|||.:|.::||||||||:|:||||:|:.||
  Fly   657 SENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGK 721

Human   611 QPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSI 666
            .||....|::||.:|.:|..|.:|...:..||.:|..||...||:||.|:.|:..:
  Fly   722 MPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQL 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMXNP_001712.1 PH_Btk 7..147 CDD:269944 50/172 (29%)
SH2_Tec_Bmx 289..394 CDD:198262 47/104 (45%)
PTKc_Btk_Bmx 412..667 CDD:173657 147/257 (57%)
CAV1-binding 596..603 4/6 (67%)
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944 51/176 (29%)
SH3_Tec_like 346..399 CDD:212702 12/69 (17%)
SH2_Tec_family 403..505 CDD:198188 48/112 (43%)
PTKc_Tec_like 521..778 CDD:173637 147/257 (57%)
Pkinase_Tyr 526..777 CDD:285015 146/250 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 316 1.000 Domainoid score I1267
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 1 1.000 - - otm42091
orthoMCL 1 0.900 - - OOG6_102306
Panther 1 1.100 - - O PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X592
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.