DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLK2 and C901

DIOPT Version :9

Sequence 1:XP_005249365.1 Gene:DLK2 / 65989 HGNCID:21113 Length:476 Species:Homo sapiens
Sequence 2:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster


Alignment Length:342 Identity:101/342 - (29%)
Similarity:138/342 - (40%) Gaps:94/342 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   102 HLVC-----LLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQH 161
            |.||     ..|:.|..|...:...|...||..:|.|...|.|||..|:.|..|::|:.:|||||
  Fly    59 HYVCDEKGDFKCLPGWQGDLCQVPMCRRGCDPMNGYCQRPGECRCRIGYSGELCDKCIPLPGCQH 123

Human   162 GTCHQPWQCICHSGWAGKFCDKDEHIC-----TTQSPCQNGGQCM----YDG----------GGE 207
            |.|.:|::|||..||||.||  .|..|     :|:..|:..|:|.    |.|          |.:
  Fly   124 GGCTKPFECICKPGWAGLFC--TEPSCRTGCHSTRGYCEAPGECRCRIGYAGRTCSECATMPGCQ 186

Human   208 Y-------HCVCLPGFHG---------RDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCL 256
            :       .|:||||:.|         .||.::.|.|.:.|.                   |||.
  Fly   187 HGTCNKPLECLCLPGYTGLLCQTPICDPDCSKQHGYCRKPGE-------------------CRCK 232

Human   257 VGFVGARCEVNVDDCLMRP-CANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRP--CQRGA 318
            ||:.|::|    |.|...| ||||    |....:.|.|..|:.|..|...|..|...|  |:.|.
  Fly   233 VGWTGSQC----DKCFPYPGCANG----DCEAPWECNCHPGWGGMLCDEKLTYCVEHPDTCENGG 289

Human   319 RCRDRVHD---FDCLCPSGYGGKTCEL----VLPVPDPPTTVDTPLGPTSAVV------------ 364
            :|.....:   :.|.|..|:.||.||:    :|....||..  ||..|...|:            
  Fly   290 KCTSLSREDGSYQCQCRQGFLGKNCEIRDDFLLTSEAPPRI--TPPTPAELVLELDGELDQNGQQ 352

Human   365 -VPATGPAPHSAGAGLL 380
             :.|..|.....|.||:
  Fly   353 DIGAGVPDDSEPGGGLV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLK2XP_005249365.1 EGF_CA 182..222 CDD:238011 16/74 (22%)
EGF_CA 267..303 CDD:238011 12/36 (33%)
EGF_CA 305..341 CDD:238011 11/40 (28%)
C901NP_572673.1 DSL <56..79 CDD:302925 6/19 (32%)
EGF_CA 280..315 CDD:238011 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4501
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.