DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A4 and CG7333

DIOPT Version :9

Sequence 1:NP_003050.2 Gene:SLC22A4 / 6583 HGNCID:10968 Length:551 Species:Homo sapiens
Sequence 2:NP_650814.2 Gene:CG7333 / 42334 FlyBaseID:FBgn0038715 Length:541 Species:Drosophila melanogaster


Alignment Length:550 Identity:150/550 - (27%)
Similarity:236/550 - (42%) Gaps:63/550 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     3 DYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCRVPDAANLS-----SAW 62
            |:.:|:...|.:|.||.:|..|...:.|....:..|...:..||||.|...|...||     |.:
  Fly     2 DFSQVLDKCGNYGRFQVMILLLYGYTNILGSLHYFSQTLITFTPEHWCFHADLNGLSVEGIRSVY 66

Human    63 RNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLST 127
            .|.|.           .||:          ..||:..|    .|.:........|.|:::....:
  Fly    67 ENISA-----------SSCT----------PLLGVVNG----TGVVSTNRKCRNWIFNRESGYES 106

Human   128 VVTEWNLVCEDNWKVPLTTSLFFVGVLLGSFVSGQLSDRFGR-KNVLFATMAVQTGFSFLQIF-- 189
            :.||...||:.:....:..|.||:|.::|:.:.|.|||:.|| .::|.||:...|| .|:..|  
  Fly   107 ITTELKWVCDKSHHPAVGQSFFFMGSVVGTIIFGYLSDQVGRLPSLLMATLCGATG-DFITSFVH 170

Human   190 SISWEMFTVLFVIVGMGQISNYVVAFILGTEILGKSVRIIFSTLGVCTFFAVGYMLLPLFAYFIR 254
            ::.|..|:..  :.|:...:.|.:.:||..|.|....|.....:.:..|:..|.|..|..|.:|.
  Fly   171 TLPWFAFSRF--MSGLSTDTMYYLMYILVFEYLSPKSRTFGLNIILAVFYCFGLMTSPWAAIWIG 233

Human   255 DWRMLLLALTVP--GVLCVPLWWFIPESPRWLISQRRFREAEDIIQKAAKMNNIAVPAVIFDSV- 316
            :||..|...::|  |||..|  :.|.||.:||:::|::.:|...::|.||.|...|...:||.. 
  Fly   234 NWRRYLWLASLPALGVLIYP--FLICESAQWLLTKRKYDDAVICLKKVAKFNRRHVEESVFDEFV 296

Human   317 -----EELN--PLKQQKAFILDLFRTRNIAIMTIMSLLLWMLTSVGYFALSLDAPNLH----GDA 370
                 .||.  .|...:...|.:|.|..:...|     |.:|.......||.|..|.:    |.:
  Fly   297 KYYRERELQDYKLNSHEDTFLAMFLTPRLRRFT-----LTLLVKSVIITLSCDVINRNMEGLGTS 356

Human   371 YLNCF-LSALIEIPAYITAWLLLRTLPRRYIIAAVLFWGGGV-----LLFIQLVPVDYYFLSIGL 429
            ....| .::::.:||.:...||...:.|:.:....||.||.:     .:...|.|.:...|...:
  Fly   357 PFKLFSFTSIVYLPAGVAILLLQNKIGRKGMACTALFVGGLITTATGFMIAHLDPTENALLLAIM 421

Human   430 VMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGVTSTASRVGSIIAPYFVYLGAYNRMLPYIVMG 494
            |.||:||.|.::.....:.||:.||.||..||..........|.:|.|.:||..|.:.||.|.:.
  Fly   422 VGLGRFGATVSYDAEIQYAAEIIPTSVRGQAVSNIHVIGLASSSLAFYVIYLAQYYKPLPSIFIS 486

Human   495 SLTVLIGILTLFFPESLGMTLPETLEQMQK 524
            .|......|.|..||:|...|||||...:|
  Fly   487 CLMFFGAGLCLTLPETLNKKLPETLADGEK 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A4NP_003050.2 2A0119 12..518 CDD:273328 144/533 (27%)
MFS 123..508 CDD:119392 112/407 (28%)
CG7333NP_650814.2 2A0119 11..510 CDD:273328 144/533 (27%)
MFS 126..499 CDD:119392 108/382 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.