DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A2 and CG31103

DIOPT Version :9

Sequence 1:NP_003049.2 Gene:SLC22A2 / 6582 HGNCID:10966 Length:555 Species:Homo sapiens
Sequence 2:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster


Alignment Length:497 Identity:123/497 - (24%)
Similarity:192/497 - (38%) Gaps:128/497 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   108 ASLDTNRSRLPLGPCRDGWVYE-----------------TPGSSIVTEFN-------LVCANSWM 148
            :||::|    .|||  :.|.|:                 ..|...:|...       :|.|:...
  Fly     3 SSLESN----TLGP--NVWDYDMVLEKIGYGKTQWVLLLVSGLLTITSVAAQQAMSIIVIASQCE 61

Human   149 LDLFQSSVNV-------GFFIGSMSIGYIADRFGRKLCLL-TTVLINAAAGVLMAISPTYTWML- 204
            .:..|:...|       |.|:.:...|||:|..||:..|| .....||...|||.:  |..|:. 
  Fly    62 FETTQAEKGVMMAASVTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFV--TSVWLFN 124

Human   205 IFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIFYQVAY----------TVGLLVLAGVA--- 256
            |..|:.|:...|.....|..::||...|: |.|.|.|...:          |..|::.:..|   
  Fly   125 IINLLVGISVGAVSAALYAYLSEFNIPRH-RAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITM 188

Human   257 --YALPHWRWLQFTVSLPNF---FFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKN-GKSLP 315
              :....||.|.....||.|   ..||||   ||||::|:||.||.||:..:..|:|.| |||:.
  Fly   189 GDFVFRPWRLLLLVSLLPGFIGGLILLYY---PESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQ 250

Human   316 ASLQRLRLEEETGKKLNPSFLDLVRTPQ-------IRKHTMILM-----YNWFTSSVLYQGLIM- 367
               |.|..:|.|.|..:|...:|:...|       |.:.|:.|.     :|:...::...|:.. 
  Fly   251 ---QVLSCDEFTLKSEDPVGENLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFS 312

Human   368 --------------HMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRI-GRRYPWAASNMVAGAA 417
                          ..|...::..:....|..||.|.....:...|.| .:.|   ..|:|.|.|
  Fly   313 SNGMQLWFPEIVNRSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTY---IDNLVVGFA 374

Human   418 CLASVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGIITP 482
            .|....|.|      :|::.|||..:.:|...|..::..|         :|...|..   |::..
  Fly   375 FLIGFSIQG------LILNPLGRKNVLLAALAVATLSGVL---------LHFMESPT---GVLVL 421

Human   483 FLVYRLTNIWLELPLMVFGV-LGLVAGGLVLLLP-ETKGKAL 522
            |.:|.|      ||    |: :.::.|.:|.|:| ..:.||:
  Fly   422 FCLYIL------LP----GLSISIMIGAIVDLVPTHLRSKAV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A2NP_003049.2 2A0119 13..525 CDD:273328 123/497 (25%)
MFS 124..492 CDD:119392 108/447 (24%)
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 115/465 (25%)
MFS 34..>189 CDD:119392 38/157 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.