DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A2 and CG4465

DIOPT Version :9

Sequence 1:NP_003049.2 Gene:SLC22A2 / 6582 HGNCID:10966 Length:555 Species:Homo sapiens
Sequence 2:NP_650847.1 Gene:CG4465 / 42374 FlyBaseID:FBgn0038750 Length:577 Species:Drosophila melanogaster


Alignment Length:601 Identity:136/601 - (22%)
Similarity:215/601 - (35%) Gaps:181/601 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     6 DDVLEH-GGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELSLRCGWSPAE 69
            |||:.| .|.|..:|     |.:||          |:||       |:.|  |...:.|      
  Fly    59 DDVITHIMGNFGPWQ-----LRSLL----------ILFL-------CKIP--AAWFMAC------ 93

Human    70 ELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLD-------TNRSRLPLGPCRDGWV 127
             :.:|.|...|..|        |:.|......| |:...|||       ...|...:..||. ::
  Fly    94 -ILFTAPDLYPEEE--------YKCDTTAFGPD-VNSTVSLDHCYVMVNYGESAYAMRQCRK-FL 147

Human   128 YETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGV 192
            |.|...|:..||:|||...:.:...|.....|..||.:                      ||..:
  Fly   148 YTTGFHSLTMEFDLVCLCDFFVAWSQYWHLFGLLIGGV----------------------AATKL 190

Human   193 LMAISP-----TYTW-MLIFRLIQGLVS--------------KAGWLI--GYILITEFVGRRYRR 235
            :..:||     |..| :|:..|:.|||.              ...::|  |..:..:....:||.
  Fly   191 MRVLSPRQIYRTGIWCLLMCSLLMGLVKDFSLHCGLRCLAAVSCCFMITSGQYIFGDITAGKYRV 255

Human   236 TVGIFYQVAYTVGLLVLAGVAYALPHWR--WLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAE 298
            ...|.|...:.:||::|.|:|...|.|:  :|..|:||....|||.:  .|:||||.:...|.|:
  Fly   256 GTLILYDCFWALGLILLPGLASNAPSWQHIYLGVTLSLLVIVFLLPW--TPDSPRWQLQHTKEAQ 318

Human   299 -----AMRIIKHIAKKNG------KSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILM 352
                 .:.|:...|:.||      |.||..|:.||              :.:..|....|.|.| 
  Fly   319 LAIERTVGILLEAARTNGRMHKVSKELPQQLEELR--------------ERMLEPMPAVHWMHL- 368

Human   353 YNWF-----------------TSSVLYQGLIMHMGLAG-DNIYLDFFYSALVEFPAAFMII-LTI 398
              |.                 |..|:..||::|:...| :::..:.....|.|....|:.: ||.
  Fly   369 --WMGQRRSTFHLVAVHMALATFMVVNTGLLLHVRSFGREHLVSNTLAMGLAEMLGCFLALHLTF 431

Human   399 DRIGRRYPWAASNMVAGAACLASVFIPGDLQW--------------LKIIISCLGRMGITMAYEI 449
            :...|::.||....:. ..|:      |.:.|              |.::::.|.:..:..|..:
  Fly   432 NLSERKWQWAGGFAIV-VGCI------GSICWFLAEEDMPEVYGLTLGLLMASLPQAAVACAQSM 489

Human   450 VCLVNAELYPTFIRNLGVHICSSMCDIGGIITPFLVYRLTNIWLELPLMVFGVLGL-------VA 507
            :.....||.|...|:     |.|.    ..:|...|::|:..:|.|...|...|.|       :.
  Fly   490 ILACLGELVPMEQRS-----CLSF----SAVTWARVWQLSASFLTLLRQVSPALSLSAFCLLVIL 545

Human   508 GGLVLLLPETKGKALP 523
            |||......|:.|..|
  Fly   546 GGLGTCCLVTRDKEQP 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A2NP_003049.2 2A0119 13..525 CDD:273328 132/593 (22%)
MFS 124..492 CDD:119392 94/435 (22%)
CG4465NP_650847.1 2A0119 67..553 CDD:273328 129/583 (22%)
MFS 169..>303 CDD:119392 35/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.