DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A2 and CG7882

DIOPT Version :9

Sequence 1:NP_003049.2 Gene:SLC22A2 / 6582 HGNCID:10966 Length:555 Species:Homo sapiens
Sequence 2:NP_610189.2 Gene:CG7882 / 35520 FlyBaseID:FBgn0033047 Length:516 Species:Drosophila melanogaster


Alignment Length:472 Identity:102/472 - (21%)
Similarity:188/472 - (39%) Gaps:101/472 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   117 LPLGPCRD----------GWVYETPGSSIVTEFNLVCANSWMLDLFQSSVN---VGFFIGSMSIG 168
            :|:|.|..          .|..||    ::..::|..:::.:..|:.:.|:   ||..|||:...
  Fly    53 VPVGYCTGVMNSPAELMRSWCNET----LIASYDLNLSDAGLEILWSAIVSIFLVGGAIGSVVGA 113

Human   169 YIADRFGRKLC-LLTTVLINAAAGVLMAISP--TYTWMLIFRLIQGLVSKAGWLIGYILI--TEF 228
            .:|:||||:.| .:..:|:...|....|..|  :...:|:.|::.||.  .|.|..::.:  :|.
  Fly   114 TMANRFGRRGCFFICGLLLGLGAISFYACRPLRSVELLLLGRMMVGLA--GGLLTSFMSMWHSEI 176

Human   229 VGRRYRRTVGIFYQVAYTVGLLV-----LAGVAYALPHWRWLQFTVSLPNFFFLLYY----WCIP 284
            .....|.|:.....:..|:|:::     |..|.....:|   .|.::......|:.|    | .|
  Fly   177 SALSQRSTLAPLCPMGLTLGVVIAQVCSLRSVLGGPENW---HFGLAFYGLLVLVCYAPFRW-YP 237

Human   285 ESPRWL-ISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKL-NPSFLDLVRTPQIRKH 347
            |||:|| |.|.:..:|.|.::.:......|.....:...:|:|:..:: ..|.:.::|.||:|..
  Fly   238 ESPKWLFIVQGRKEDARRQLQLLRGYTAGSAALKAEMEEMEQESACEVKTSSLMQVLRDPQLRLP 302

Human   348 TMIL--------------MYNWFTSSVLYQGLI------MHMGLAGDNIYLDFFYSALVE----- 387
            .:|:              ::.:..|.....||.      .::|....|::.......|:|     
  Fly   303 LIIVCAFLGGQQLSGINAIFYYSVSIFRKAGLSSQASEWANLGAGSLNLFASMLGPVLLERVNRR 367

Human   388 --------FPAAFMIILTIDRIG-RRYPWAASNMVAGAACLASVFIPGDLQWLKIIISCLGRMGI 443
                    |.|.|:::..|.... ..|.|      .|..|:..:|:     ::......||.|..
  Fly   368 PLMLFSTFFCAVFLLLFAIMLFFIESYSW------FGMGCIGCIFL-----YIFFFQFGLGPMPF 421

Human   444 TMAYEIVCLVNAELYPTFIRNLGVHICSS---MCD-IGGIITPFLVYRLTNIWLELPLMVFGVLG 504
                    .:.|||:....|...:.:.|.   :|: |.|:..|    .:.|:|..|..:.|.|..
  Fly   422 --------FIGAELFELATRPAAMSLGSLAYWLCNFIIGMAFP----TMQNLWGALVFLPFSVTC 474

Human   505 LVAGGLV-LLLPETKGK 520
            |:..||. ..||||:|:
  Fly   475 LLIFGLTKRYLPETRGR 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A2NP_003049.2 2A0119 13..525 CDD:273328 102/472 (22%)
MFS 124..492 CDD:119392 87/434 (20%)
CG7882NP_610189.2 Sugar_tr 43..491 CDD:278511 101/470 (21%)
MFS 95..480 CDD:119392 87/413 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326501at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.