DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A2 and CG31106

DIOPT Version :9

Sequence 1:NP_003049.2 Gene:SLC22A2 / 6582 HGNCID:10966 Length:555 Species:Homo sapiens
Sequence 2:NP_733086.2 Gene:CG31106 / 318594 FlyBaseID:FBgn0051106 Length:513 Species:Drosophila melanogaster


Alignment Length:470 Identity:114/470 - (24%)
Similarity:189/470 - (40%) Gaps:92/470 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   127 VYETPGSSIVT-----EFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLI 186
            :.||.|.|.:|     :|.:   ||....:..::..:|.|..|...||::|..||:..|:.|.:.
  Fly    54 INETMGMSYITIVSQCDFEM---NSMDKAVMSAASFIGIFCSSYFWGYLSDTIGRRPVLIYTTIA 115

Human   187 NAAAGVLMAISPTYTWMLIF-RLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGL- 249
            .....:...:.|.| |:.:| |...|..........|..:.||...|: |.:.|.|...: ||: 
  Fly   116 GNFLSLCSTVIPNY-WLYVFIRFGVGFFIAGASSTTYAYLGEFFTPRH-RPIAINYASLF-VGVS 177

Human   250 ---------LVLA---GVA----YALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAE 298
                     |:|:   .|:    ::|..||.|.....||.....|..|.:||||:.|:|.:|..|
  Fly   178 TVYVPATAWLILSMDWSVSITDGFSLRPWRLLTICYLLPGVVGTLMLWSLPESPKILMSLHKTEE 242

Human   299 AMRIIKHIAKKN-GKSL-PASLQRLRLEEE---------------TGKKLNPSFLDLVRTPQIRK 346
            |...:..||..| ||.| ...:.:|:.|:.               |.||:....|.|:|.|.:..
  Fly   243 AFAAVDWIAVTNSGKHLHEFKVHKLKTEDNANGENILLISKSAFTTIKKMWKETLPLLRRPHLLN 307

Human   347 HTM---ILMYNWFTSS---VLYQGLIMHMG----------------------------LAGDNI- 376
            ..:   |:...:|:||   :.|..:...:|                            :..|:| 
  Fly   308 FVISCTIMCGLFFSSSGMGLWYPEIQNRLGSNAADDSMTVCQVIDASIDQMQANASNKICDDHIN 372

Human   377 ---YLD--FFYSALVEFPAAFMII-LTIDRIGRRYPWAASNMVAGAACLASVFIPGDLQWLKIII 435
               |:|  .:.|||:   ..:::: |.|:.|||:...:....:|||..:|.:||..::  ..::.
  Fly   373 TKSYIDTITYGSALI---VGYILMGLVINTIGRKASISIGLTLAGACAIALIFIKDEV--AIVVC 432

Human   436 SCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGIITPFLVYRLTNIWLELPLMVF 500
            .||..:...:...|:.....:|.||.:|...|.||..:...|.:....::..|...:..|...||
  Fly   433 FCLYLVLPGLCVSILSGAVVDLVPTHLRGKAVCICLMLGRTGSVFGSNIIGVLLESYCSLTFGVF 497

Human   501 GVLGLVAGGLVLLLP 515
            ....||...|.||||
  Fly   498 SGFVLVCASLTLLLP 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A2NP_003049.2 2A0119 13..525 CDD:273328 114/470 (24%)
MFS 124..492 CDD:119392 104/445 (23%)
CG31106NP_733086.2 2A0115 37..486 CDD:273327 103/442 (23%)
MFS 40..512 CDD:119392 112/468 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.