DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A2 and CG33233

DIOPT Version :9

Sequence 1:NP_003049.2 Gene:SLC22A2 / 6582 HGNCID:10966 Length:555 Species:Homo sapiens
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:471 Identity:99/471 - (21%)
Similarity:182/471 - (38%) Gaps:93/471 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   126 WVYETPGSSIVTEFNLVCANSWMLD-------LFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTT 183
            ::|....:..:|...||...|...|       |..:|:..|.....:.||::|||:|||..:...
  Fly    28 FIYMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLLGGMVASGLFIGFLADRYGRKFVIRLA 92

Human   184 VLINAAAGVLMAISPTYTWMLIFRLIQG--LVSKAGWLIGYILITEFVGRRYRR-TVGIFYQ--- 242
            ::...:..|:.|:.|....:.:.|:|.|  |.:.|...:|:  :.||...::|. ||.|..|   
  Fly    93 LVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVGF--LGEFHAIKWRPITVAICSQSQG 155

Human   243 --VAY--TVGLLVL-------AGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKN 296
              :.|  .|.:.:|       ...:|.|..||:|.....:|.:..|:....:||:|.:|:|.|:.
  Fly   156 LALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRP 220

Human   297 AEAMRIIKHIAKKNGK-----SLPASLQRLRLEEETG--KKLNPSFLDLVRTPQIRKH--TMILM 352
            .:|:..:|.|.:.|.|     .:..|.::....::.|  |.:...:..|...|.:.|.  .:.|:
  Fly   221 DKALLALKWICRMNRKKWEDVDITLSEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICLFLI 285

Human   353 YNWFTSSV---LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIG--RRYPWAASNM 412
            :..|.:|:   ::..:|.:|..:|.|...|     ||.....|:.....|..|  ...|.....|
  Fly   286 FGIFFTSIGLGIWFPVIRNMDNSGSNRLCD-----LVNNNPTFINHEADDTNGTDSESPKCNDEM 345

Human   413 V------------AGAACLASVFIPGDLQW--------LKIIISCLGRMGIT---MAYEIVCL-- 452
            .            .|...||||.:    .|        |.|:||.:  :||:   |....|.|  
  Fly   346 TNLIDPVYYGFTYIGCFILASVLV----HWMTRKYVIALHILISMI--LGISLNIMKQPTVVLIF 404

Human   453 -----------------VNAELYPTFIRNLGVHICSSMCDIGGIITPFLVYRLTNIWLELPLMVF 500
                             |..:..|..:|...:.:..|:...||::...::.....:..::...:|
  Fly   405 FVLMMVLPGVLIPLATSVLVDCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIF 469

Human   501 GVLGLVAGGLVLLLPE 516
            .:...:...|.:..|:
  Fly   470 NLCLAICVVLAVFQPK 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A2NP_003049.2 2A0119 13..525 CDD:273328 99/471 (21%)
MFS 124..492 CDD:119392 96/445 (22%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 96/435 (22%)
MFS 23..>208 CDD:119392 43/181 (24%)
MFS 354..>482 CDD:304372 23/133 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.