DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A1 and CG31103

DIOPT Version :9

Sequence 1:XP_005267159.1 Gene:SLC22A1 / 6580 HGNCID:10963 Length:610 Species:Homo sapiens
Sequence 2:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster


Alignment Length:394 Identity:113/394 - (28%)
Similarity:159/394 - (40%) Gaps:102/394 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   167 GYFADRFGRKLCLL-GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLV--SKGNWMAG-YTLITEF 227
            ||.:|..||:..|| |....||:..|||..:    |:.||.::..||  |.|...|. |..::||
  Fly    88 GYISDDIGRRRVLLYGNFASNALQFVLMFVT----SVWLFNIINLLVGISVGAVSAALYAYLSEF 148

Human   228 VGSGSRRTVAIMYQMAF----------TVGLV-----ALTGLAYALPHWRWLQLAVSLPTF---L 274
             .....|.|||.|...|          |..||     |:|...:....||.|.|...||.|   |
  Fly   149 -NIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPGFIGGL 212

Human   275 FLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKN-GK----LPPADLKMLSLEEDVTE------ 328
            .||||   ||||::||||::|.|||:.:..|::.| ||    :...|...|..|:.|.|      
  Fly   213 ILLYY---PESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSEDPVGENLLGES 274

Human   329 -------KLSPSFADLFRTPRLRKRTFIL--------------MYLWFTDSVLYQGLILHMGATS 372
                   |:..:...||..|  ....|||              |.|||.:.|....     ||.:
  Fly   275 QGCGILSKICRATIPLFHKP--HGFNFILCNLALFGMFFSSNGMQLWFPEIVNRSS-----GAEN 332

Human   373 GNLYLDFLYSALVEIPG----------------------AFIALITIDRVGRIY-PMAMSNLLAG 414
            .:..:..:.|..||.|.                      .|..||.....|.|. |:...|:|. 
  Fly   333 NSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPLGRKNVLL- 396

Human   415 AACLVMIFISPDLHWLN-----IIIMCVGRM--GITIAIQMICLVNAELYPTFVRNLGVMVCSSL 472
            ||..|.......||::.     :::.|:..:  |::|:|.:..:|  :|.||.:|:..|..|.||
  Fly   397 AALAVATLSGVLLHFMESPTGVLVLFCLYILLPGLSISIMIGAIV--DLVPTHLRSKAVSFCMSL 459

Human   473 CDIG 476
            ..:|
  Fly   460 GRLG 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A1XP_005267159.1 2A0119 12..499 CDD:273328 113/394 (29%)
MFS 118..484 CDD:119392 113/394 (29%)
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 113/394 (29%)
MFS 34..>189 CDD:119392 35/105 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.