DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A1 and sea

DIOPT Version :9

Sequence 1:NP_001243463.1 Gene:SLC25A1 / 6576 HGNCID:10979 Length:318 Species:Homo sapiens
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:305 Identity:196/305 - (64%)
Similarity:237/305 - (77%) Gaps:10/305 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    21 PERQRP------GGSLRSG----FPVPAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIG 75
            |.|:||      ..:..||    ..:.|||:.||||||||:|||||||||||||:....:|.||.
  Fly    12 PYRRRPWMTEHGAAAADSGQVGLKGIVAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIF 76

Human    76 DCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGV 140
            |||::||...|.||||||||.|:||||||:|.|||.||||.::..|::|:|.::..|||||||||
  Fly    77 DCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGAGV 141

Human   141 AEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIR 205
            .||:|.|.||||||||||:||.|.|||:|||.|||.:|::.:|:.|.|:|||.|:||||||||||
  Fly   142 CEAIVAVTPMETIKVKFINDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIR 206

Human   206 FFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCG 270
            |||:.||::.|:||:..||:..|:.||||||||||||||||||||:|||||||||.||:||..|.
  Fly   207 FFVLESLKDLYKGDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCA 271

Human   271 LQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVW 315
            ::|||.||..|||||||||||||||||||.|:|||..:.|.||||
  Fly   272 VEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYDSFMDLFNKVW 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A1NP_001243463.1 PTZ00169 38..311 CDD:240302 185/272 (68%)
Mito_carr 38..121 CDD:278578 56/82 (68%)
Mito_carr <148..220 CDD:278578 47/71 (66%)
Mito_carr 223..313 CDD:278578 66/89 (74%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 181/267 (68%)
Mito_carr 34..117 CDD:278578 55/82 (67%)
Mito_carr 125..220 CDD:278578 61/94 (65%)
Mito_carr 235..314 CDD:278578 60/78 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I5132
eggNOG 1 0.900 - - E1_KOG0756
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 401 1.000 Inparanoid score I1939
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58666
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002928
OrthoInspector 1 1.000 - - oto90200
orthoMCL 1 0.900 - - OOG6_104005
Panther 1 1.100 - - LDO PTHR45788
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1828
SonicParanoid 1 1.000 - - X3276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.