DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMPR1A and tkv

DIOPT Version :9

Sequence 1:NP_004320.2 Gene:BMPR1A / 657 HGNCID:1076 Length:532 Species:Homo sapiens
Sequence 2:NP_787990.1 Gene:tkv / 33753 FlyBaseID:FBgn0003716 Length:575 Species:Drosophila melanogaster


Alignment Length:537 Identity:273/537 - (50%)
Similarity:338/537 - (62%) Gaps:62/537 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    26 LDSMLHGTGMKS----DSDQKKS---ENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCIT--NGH 81
            |..|..|:|..|    |:|.:||   ||..:|.         |||.|.|||:..|.||.|  .|.
  Fly    50 LSGMEMGSGPGSEGYEDADNEKSKTVENARSLT---------CYCDGSCPDNVSNGTCETRPGGS 105

Human    82 CFAIIE---EDDQG--ETTLASGCMKYE--GSDFQCKDSPKAQLR-RTIECC-RTNLCNQYLQPT 137
            ||:.::   ::..|  |.....|||..|  |....||.:....|. :.|.|| :.:.||:.|.||
  Fly   106 CFSAVQQLYDETTGMYEEERTYGCMPPEDNGGFLMCKVAAVPHLHGKNIVCCDKEDFCNRDLYPT 170

Human   138 LPPVVIGPFFD--------------GSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRR 188
            ..|.:..|..|              |||     :||::|  ..:|:.|.||.||...|.....|.
  Fly   171 YTPKLTTPAPDLPVSSESLHTLAVFGSI-----IISLSV--FMLIVASLCFTYKRREKLRKQPRL 228

Human   189 YNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKW 253
            .|.......:      .|..|::  |||||||||||||||||||||||||.||||||||||:.||
  Fly   229 INSMCNSQLS------PLSQLVE--QSSGSGSGLPLLVQRTIAKQIQMVRLVGKGRYGEVWLAKW 285

Human   254 RGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLY 318
            |.|:||||.|||||||||||||||||||||||:||||||||||||.|||||:.|||||||.|||:
  Fly   286 RDERVAVKTFFTTEEASWFRETEIYQTVLMRHDNILGFIAADIKGNGSWTQMLLITDYHEMGSLH 350

Human   319 DFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGL 383
            |:|..:.::.:.|..||:|.|.||.|||.||:||.|||||||||:||||||:|:||.|.|||.||
  Fly   351 DYLSMSVINPQKLQLLAFSLASGLAHLHDEIFGTPGKPAIAHRDIKSKNILVKRNGQCAIADFGL 415

Human   384 AVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCIT-- 446
            |||:||:.:.:.:..|.||||:||||||||.:.|:...|:.:..||:||.||::|||.|||.|  
  Fly   416 AVKYNSELDVIHIAQNPRVGTRRYMAPEVLSQQLDPKQFEEFKRADMYSVGLVLWEMTRRCYTPV 480

Human   447 GG----IVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHN 507
            .|    ..|:|.|||:::|||||::|||..|||||..||.:.:||..|:.|..|.|:|.|||..|
  Fly   481 SGTKTTTCEDYALPYHDVVPSDPTFEDMHAVVCVKGFRPPIPSRWQEDDVLATVSKIMQECWHPN 545

Human   508 PASRLTALRIKKTLAKM 524
            |..||||||:||||.::
  Fly   546 PTVRLTALRVKKTLGRL 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMPR1ANP_004320.2 Activin_recp 59..138 CDD:279413 31/89 (35%)
Mediates specificity for BMP ligand. /evidence=ECO:0000269|PubMed:22799562 107..109 0/1 (0%)
STYKc 234..521 CDD:214568 187/292 (64%)
STKc_BMPR1a 238..524 CDD:271122 185/291 (64%)
tkvNP_787990.1 Activin_recp 81..171 CDD:279413 32/98 (33%)
GS 238..266 CDD:197743 21/35 (60%)
S_TKc 267..557 CDD:214567 184/289 (64%)
STKc_BMPR1 270..562 CDD:271046 185/291 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 490 1.000 Inparanoid score I1427
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D338017at33208
OrthoFinder 1 1.000 - - FOG0000203
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105740
Panther 1 1.100 - - LDO PTHR23255
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2798
SonicParanoid 1 1.000 - - X151
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.