DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC17A1 and dmGlut

DIOPT Version :9

Sequence 1:XP_016866688.1 Gene:SLC17A1 / 6568 HGNCID:10929 Length:517 Species:Homo sapiens
Sequence 2:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster


Alignment Length:445 Identity:135/445 - (30%)
Similarity:211/445 - (47%) Gaps:44/445 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    87 RACLNLTMVVMV---NSTDPHGLPNTSTKKLLDNIKNP-----------MYNWSPDIQGIILSST 137
            |.||:..:.|:|   ||||...          :.|..|           .:.||.::||:||||.
  Fly    38 RVCLSQAITVLVVKKNSTDDDS----------EAICEPDDIDEGTSVGGDFEWSEELQGLILSSF 92

Human   138 SYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSVLSLLIPPAAGIGVA-WVVVCRAVQGAAQGIVA 201
            ..|.|:..:|.|..:..:..|..:|..:..::|.::|.|.|...|.: |::|.|.:.|..:|...
  Fly    93 YIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLAINKGDSDWLIVTRVLMGLGEGTTF 157

Human   202 TAQFEIYVKWAPPLERGRLTSMSTSGFLLGPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLW 266
            .|...:...|.|..|||:|.::...|..:|..:..|::||..::.||..|||.||..|    ::|
  Fly   158 PALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFIDAYGWEFVFYFFGGLG----VVW 218

Human   267 FVLF----YDDPKDHPCISISEKEYITSSLVQQVSS-SRQS----LPIKAILKSLPVWAISTGSF 322
            |.:|    |.||..||.|..||:||    ||:::.: ||..    .|.||||.:||::|:.....
  Fly   219 FAIFMFLCYSDPTSHPFIKPSEREY----LVKEIGTISRNEDLPPTPWKAILTNLPMFALVAAQI 279

Human   323 TFFWSHNIMTLYTPMFINSMLHVNIKENGFLSSLPYLFAWICGNLAGQLSDFFLTRNILSVIAVR 387
            ...|...||....|.::..:|..:||.||..|||||:..||....:|.::|:.:.|.:||....|
  Fly   280 GHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSGFVADWMIRRGVLSTTNTR 344

Human   388 KLFTAAGFLLPAIFGVCLPYLS-STFYSIVIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKAC 451
            |:.|......||||.|...|.. .....:|:|.|..|..|:: ..|:.::.||::|.|.|.:.|.
  Fly   345 KVMTGLAAFGPAIFMVGASYAGCDRVLVVVLFTICMGLMGAY-YAGMKLSPLDMSPNYAGTLMAI 408

Human   452 STLTGMIGGLIASTLTGLILKQDPESAWFKTFILMAAINVTGLIFYLIVATAEIQ 506
            :...|.|.|:|...|.|::........|...|.:...:.....:.|.|.|:.|:|
  Fly   409 TNGIGAITGVITPYLVGVMTPNASLLEWRLVFWVAFGVLCFTAVIYCIWASGEVQ 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC17A1XP_016866688.1 None
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 134/443 (30%)
MFS 77..458 CDD:119392 121/389 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148701
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D347586at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.