DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC16A2 and hrm

DIOPT Version :9

Sequence 1:NP_006508.2 Gene:SLC16A2 / 6567 HGNCID:10923 Length:539 Species:Homo sapiens
Sequence 2:NP_001286141.1 Gene:hrm / 35499 FlyBaseID:FBgn0033028 Length:658 Species:Drosophila melanogaster


Alignment Length:612 Identity:119/612 - (19%)
Similarity:207/612 - (33%) Gaps:197/612 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    94 PPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCS 158
            ||:||:||:|:..:...|..|.|...|.|:|:|    |..:.......:|||:.||...:.....
  Fly    49 PPDGGWGWLVLLGSCLTNILIPGTIKSFGVLFS----EFTDAFNSSPTKAAWIPALCYFLYSSLG 109

Human   159 PIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHY 223
            |:.||.:.:...|.....|.|.|.:|:..|.:.||:...|.:||:|.|.|...:|.|::.|:..|
  Fly   110 PVSSILSVKYSYRTVTLLGGASASLGMILSFWASSIEFLYISYGVLVGIGAGLSFPPTVYIVTSY 174

Human   224 FQRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTY-------- 280
            |.:..|||||:..:||::.|:..|.|:|.|.:......:..::......:.:.:|.|        
  Fly   175 FAKLRGLANGLCISGSALGSIILPPLLRWLLETYGYHGSCLIMGGITLNVFVAALFYEPVEQHMV 239

Human   281 --------------------------------------RPLLP---------------------- 285
                                                  :||||                      
  Fly   240 RVPRARQALENIPEEEDIGIVMKFENVDEPVPKNEPADKPLLPYNSPPSPLYLPGDERLQFVRSA 304

Human   286 ---------------------------------------------------------------SS 287
                                                                           ||
  Fly   305 SAAVVQSYSKSGDEFQSRSRKISTPVRLPQRNQTFTPGQLNSQSSLYAVPEGRSSSNKLTLRNSS 369

Human   288 QDTPSKRGVRT---------LHQRFLA-------------------------------------- 305
            :...|||...|         .|...|:                                      
  Fly   370 KSRLSKRSPSTSSFLYVSTPYHGSTLSFQPKEFSSHLSLRSMGSSGTGHAGDSTGQDGSYADVDA 434

Human   306 -------QLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEE-FSEIKETWVLLVC 362
                   |..|:|::.:.:...|.:.....:..|:.|....:.|..:.|.. |::....::|.| 
  Fly   435 RGQAQQPQRSKFFDLSLLKDPMYLVILISNSTNAISYTNFIILLPSFGEARGFNKSLSAYLLSV- 498

Human   363 IGATSGLGRLVSGHISDS--IPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDG 425
            :.||..:||:....:||.  ||   |.:..|....:.||...::|....:..:...|...||..|
  Fly   499 VSATDLIGRIGGSALSDMGYIP---KTWYFVGGLSISGLSLALLPFAWTYSSVCFWCALFGLASG 560

Human   426 FFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIG 490
            .::.|.|.|..:::|..:.:.:.|..|.:..|..:.|||:.........||:..|:..|:..:.|
  Fly   561 IYVGITAVIMADMLGTERLTSSYGISLFVNGLLQLVGPPLCNYWFEAVNDYNPLFHALGLTLLAG 625

Human   491 AVILFFVPLMHQRMFK-KEQRDSSKDK 516
            |.:..|:|.:::|... :||.|:..:|
  Fly   626 ASLWSFMPWINRRKANAEEQLDAQIEK 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC16A2NP_006508.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92
2A0113 86..513 CDD:273325 118/607 (19%)
MFS 101..498 CDD:119392 108/584 (18%)
DUF1564 <286..>334 CDD:284922 13/101 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..539 4/9 (44%)
hrmNP_001286141.1 2A0113 49..653 CDD:273325 119/612 (19%)
MFS 59..>234 CDD:119392 49/178 (28%)
MFS <449..633 CDD:119392 42/187 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 1 1.000 - - FOG0000033
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.