Sequence 1: | NP_006508.2 | Gene: | SLC16A2 / 6567 | HGNCID: | 10923 | Length: | 539 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285435.1 | Gene: | out / 32926 | FlyBaseID: | FBgn0259834 | Length: | 655 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 48/202 - (23%) |
---|---|---|---|
Similarity: | 84/202 - (41%) | Gaps: | 22/202 - (10%) |
- Green bases have known domain annotations that are detailed below.
Human 92 FQPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFF 156
Human 157 CSPIVSIFTDRLGCRIT----ATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSL 217
Human 218 VILGHYF----QRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQ-TFQVLSTFMFVLMLLS 277
Human 278 LTYRPLL 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SLC16A2 | NP_006508.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..92 | 48/202 (24%) | |
2A0113 | 86..513 | CDD:273325 | 48/202 (24%) | ||
MFS | 101..498 | CDD:119392 | 43/193 (22%) | ||
DUF1564 | <286..>334 | CDD:284922 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 508..539 | ||||
out | NP_001285435.1 | MFS | 45..>225 | CDD:119392 | 43/193 (22%) |
MFS | <464..621 | CDD:119392 | |||
MFS_1 | 468..>621 | CDD:284993 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165145512 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2504 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D916876at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.750 |