DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC16A2 and CG8028

DIOPT Version :9

Sequence 1:NP_006508.2 Gene:SLC16A2 / 6567 HGNCID:10923 Length:539 Species:Homo sapiens
Sequence 2:NP_001097031.2 Gene:CG8028 / 32923 FlyBaseID:FBgn0031010 Length:563 Species:Drosophila melanogaster


Alignment Length:565 Identity:110/565 - (19%)
Similarity:184/565 - (32%) Gaps:204/565 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    93 QPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGA--LAMGMI- 154
            :.|:||:|.:|.........|......|.|:::...|:.              :||  .||.:| 
  Fly    32 EAPDGGWGILVCIGMALPFTSALAALPSFGLVFGEFLKS--------------IGAETSAMAIIT 82

Human   155 --FFCS-PIVSIFT----DRLGCRITATAGAAVAFIGLHTSSF-TSSLSL-------RYFTYGIL 204
              ||.| ....:|:    .|.|.|.....|..:.|:|.....| ||:|.|       :.|.:|::
  Fly    83 SAFFSSMSFAGLFSGSLFQRFGMRQVGVTGGILYFLGTGMQLFATSTLHLIMAFSVVQGFAFGLM 147

Human   205 F-GCGCSFAFQPSLVILGHYFQRR----LGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQTFQ 264
            . .|..:|         .|||.:.    :..|..::..|    ||.:|.:::.|           
  Fly   148 VPTCYTTF---------NHYFVKNRVMWMSFAQTLIGLG----SMLYPIVMQKL----------- 188

Human   265 VLSTFMFVLMLLSLT---------------------YRPLLPSSQ----------------DTPS 292
             :|.:.|...||.||                     ..|:.|..|                :||.
  Fly   189 -MSWYGFRGCLLILTGLNAHAVFGMLVMHPVEWHMRRVPIQPEEQEELKELSPTVVIRVQPETPL 252

Human   293 KR------------GVRTL-HQRFLAQLRKYFNMRVFRQRTYRIWAFGIA--------------- 329
            |.            |.|.| |..  .|:.|..:.|.....:...|:..:.               
  Fly   253 KATREEPNFHTADPGARKLSHAE--EQMLKVLSSRASSITSLGNWSGPVVVSDASPQMMHSLQTS 315

Human   330 ------AAALGYFVPYVHLMK--YVEE-----EFSEIKETWVLLVCIGATSGLGRLVSGHISD-S 380
                  |.|.|...| .|..|  :|..     :.:.:|:...:.:.:|.|..|       .|| :
  Fly   316 RRPSTIAGASGAVAP-AHATKKSWVRTIVDFLDLTLLKKPIFVNIVLGITFAL-------YSDIT 372

Human   381 IPGLKKIYLQVLSF--------LLLGLMSMMIPLCRDFGGLIVVCL-----FLGLCDGFFITIMA 432
            ...::.:||..|.:        :.:|..:.:  ..|.|..:..||:     ::.|....| |:.|
  Fly   373 FFTMQPVYLFELGYSRPDTATIIAIGAAADL--ASRIFLAITAVCIQVPSRYIYLAGAVF-TVFA 434

Human   433 PIAF----ELVGPMQASQAIGYLLGMMALPM----------------------IAG------PPI 465
            ..||    :.||....:..||:|...:.:|:                      |.|      .||
  Fly   435 RFAFNGITQFVGMACITAVIGFLRTWLHVPLPLVFADYLPKERFATGYGLFMFIQGNAMFLIGPI 499

Human   466 AGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQR 510
            .|.:|:...||...|:.     :.|.:||...|.:.:.:..|.:|
  Fly   500 VGFIRDKTRDYIFVFHI-----LNGFMILCAAPWVLEVLIVKFRR 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC16A2NP_006508.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92
2A0113 86..513 CDD:273325 110/565 (19%)
MFS 101..498 CDD:119392 103/543 (19%)
DUF1564 <286..>334 CDD:284922 14/97 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..539 1/3 (33%)
CG8028NP_001097031.2 MFS 40..>215 CDD:119392 44/213 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.