DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC16A1 and CG8389

DIOPT Version :9

Sequence 1:NP_001159968.1 Gene:SLC16A1 / 6566 HGNCID:10922 Length:500 Species:Homo sapiens
Sequence 2:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster


Alignment Length:498 Identity:119/498 - (23%)
Similarity:204/498 - (40%) Gaps:71/498 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    14 PDGGWGWAVVIGAFISIGFSYAFPKSI--TVFFKEIEGIFHATTSEVSWISSIMLAVMYGG---G 73
            ||||:|| :|:.|...|..:.....|:  .:|..|::.:...|.:.....:...||:.:.|   |
  Fly    10 PDGGYGW-IVVAAVALINMTNQSILSVFGQLFVGELQKMQEDTFTAALITNLNSLALNFSGLFIG 73

Human    74 PISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIG---VIG-GLGLAFNLNPALTM 134
            |    .:..:..|.|...|..|...||...:|.:  :..:..:|   .:| ||||   ::|:..|
  Fly    74 P----AIKSFKPRNVAATGCILVALGLALCAFAS--ESWHFILGYSFFVGFGLGL---ISPSTFM 129

Human   135 -IGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPI 198
             |..||..:|..|.|:::||:.:....:..|.:......|:|.:.|.:..|.|......|.::|:
  Fly   130 AINSYFTTKRGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSLFGLFGAAFLKPL 194

Human   199 GPKPTKAGKDK-----SKASLEKAGKSGVKKDLHDANTDLIGRHPKQEK---RSVFQTINQFLDL 255
            .| |.|....|     ::|..||.  |.::..:...|...|.|.|....   ..:.|.:.|.:||
  Fly   195 NP-PAKHNNRKHIRLLTEADGEKT--SPLQVVIVPTNQSKIERSPPNVDTLCSRMGQRLVQAMDL 256

Human   256 TLFTHRGFLLYLSGNVIMFFG-LFAPLVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLV 319
            .|.....|...:.|..:::.. :...::|....|::...:|:..||.:|::|..|:|.|..:.:|
  Fly   257 ELLKDLVFWSIIVGMALVYTATINFTMIFPGFLGQTAQLNSQMVAFCMSLVAGADIVFRLLLPIV 321

Human   320 ANTKPIRPRIQY-------FFAASVVANGVCHMLAPLSTTYVGFCVYAGFFGFAFGWLSSVLF-- 375
            .:...|..|:.:       |.|..|:|.   :...|:..|   ..|..|....|....:::..  
  Fly   322 TDHLRIPYRVVFLIGIVGLFVARCVLAE---NQTLPVIIT---MSVLTGMMKSATVINNNLTISA 380

Human   376 ----ETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYKYTYWACGVVLIISGIY 436
                |.|...:|....|..|.::|:.:         |||.:.|....|....:|.||:|::  :.
  Fly   381 HCRSEKLAGGLGLSMMSKGVIVITVGQ---------LLGWVRDYADSYLICLYAQGVILLV--VV 434

Human   437 LFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTK 479
            |.....|.||  .:.|:....|   ..|..|||.|    ||.|
  Fly   435 LVWTPEILYR--HRRQRCATNK---SMETQSIDAA----EVAK 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC16A1NP_001159968.1 2A0113 1..455 CDD:273325 110/472 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..500 9/26 (35%)
CG8389NP_611076.2 MFS 19..425 CDD:119392 94/432 (22%)
MFS_1 19..400 CDD:284993 87/398 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.