DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC6A12 and CG31904

DIOPT Version :10

Sequence 1:NP_003035.3 Gene:SLC6A12 / 6539 HGNCID:11045 Length:614 Species:Homo sapiens
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:144 Identity:42/144 - (29%)
Similarity:71/144 - (49%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    34 KDRGQWTNKMEFVLS---------VAGEIIGLGNVWRFPYLCYKNGGG-AFFIPYFIFFFVCGIP 88
            |.||:|....:|..:         :..|:...|.:         :||. .|.|.|.:......:|
  Fly    82 KCRGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---------HGGWLLFIIAYLMGMLFYSLP 137

Human    89 VFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWALFYLFSSFTSELP 153
            :|.::..|||::|.|:::|:| :.|:|:|||.|.:::......||.|.....|.|..:|....:|
  Fly   138 IFLIQAFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIP 201

Human   154 WTTCNNFWNTEHCT 167
            |.:|||.|||:.|:
  Fly   202 WMSCNNSWNTQECS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC6A12NP_003035.3 SLC6sbd_BGT1 35..575 CDD:212080 41/143 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 576..614
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 33/94 (35%)
Cuticle_4 276..344 CDD:464954
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.