DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB8A and C17F4.8

DIOPT Version :10

Sequence 1:NP_001035531.2 Gene:ZBTB8A / 653121 HGNCID:24172 Length:441 Species:Homo sapiens
Sequence 2:NP_494485.2 Gene:C17F4.8 / 182739 WormBaseID:WBGene00015914 Length:207 Species:Caenorhabditis elegans


Alignment Length:113 Identity:32/113 - (28%)
Similarity:55/113 - (48%) Gaps:4/113 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    30 VEGKVFKAHRNVLFASSGYFKMLLSQNSKETSQPTTATFQAFSPDTFTVILDFVYSGKLSLTGQ- 93
            |.|.||:..::.|....|:|||:|..:.......:...|...||..|.:||:|:..|.:.|..| 
 Worm    12 VGGTVFQTSKSTLTMIDGFFKMMLESDIPLQKDDSNCIFIDRSPKHFDIILNFLRDGDVDLPEQE 76

Human    94 -NVIEVMSAASFLQMTDVISVCKTFIKSSLD--ISEKEKDRYFSLSDK 138
             .:.||...|.|..:.:::.:|...|.:.:.  ||..||..:::.:||
 Worm    77 KEINEVKREAQFYLLEELVDLCHRKINTKIRVLISGTEKIEFYTKNDK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB8ANP_001035531.2 BTB_POZ_ZBTB8A_BOZF1 3..118 CDD:349638 25/89 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..251
zf-H2C2_5 282..306 CDD:404746
C2H2 Zn finger 284..304 CDD:275368
zf-H2C2_2 296..321 CDD:463886
C2H2 Zn finger 312..331 CDD:275368
C17F4.8NP_494485.2 BTB_2 8..98 CDD:426665 24/85 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.