DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf130 and APE3

DIOPT Version :9

Sequence 1:XP_038942740.1 Gene:Rnf130 / 652955 RGDID:1562041 Length:439 Species:Rattus norvegicus
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:50/164 - (30%)
Similarity:76/164 - (46%) Gaps:22/164 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat    32 QEYYTALINVTVQ--EPGRGTPLTFRIDRGRYGLDSPKAEVRGQVLAPLPIHGVA------DHLG 88
            |:||    :|::|  |...|..::|.:.....|  ...|......|:| |:.|..      .:||
Yeast   129 QDYY----DVSLQEFEALSGKIISFNLSDAETG--KSFANTTAFALSP-PVDGFVGKLVEIPNLG 186

  Rat    89 CDPQT-RFFVPP--NIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYNN--KSKEE-PVTMTHP 147
            |:.:. ...|||  |.|| |||::||.|.|.:|.:.|......|||||:|  ||||. ..|:..|
Yeast   187 CEEKDYASVVPPRHNEKQ-IALIERGKCPFGDKSNLAGKFGFTAVVIYDNEPKSKEGLHGTLGEP 250

  Rat   148 GTGDIIAVMITELRGKDILSYLEKNISVQMTIAV 181
            ....:..|.:....||.:::.:..||...:..|:
Yeast   251 TKHTVATVGVPYKVGKKLIANIALNIDYSLYFAM 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf130XP_038942740.1 PA_GRAIL_like 40..179 CDD:239037 46/152 (30%)
HRD1 <197..366 CDD:227568
RING-H2_RNF130 262..310 CDD:319717
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 50/164 (30%)
PA_ScAPY_like 155..284 CDD:239045 41/132 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.