DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf130 and meu34

DIOPT Version :9

Sequence 1:XP_038942740.1 Gene:Rnf130 / 652955 RGDID:1562041 Length:439 Species:Rattus norvegicus
Sequence 2:NP_593329.1 Gene:meu34 / 2543036 PomBaseID:SPAC3A12.03c Length:309 Species:Schizosaccharomyces pombe


Alignment Length:221 Identity:48/221 - (21%)
Similarity:75/221 - (33%) Gaps:93/221 - (42%)


- Green bases have known domain annotations that are detailed below.


  Rat    99 PNIKQWIALLQ---RGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGDIIAVMITEL 160
            |.|| |:...:   :|..||                 .:|:|:.:.|.:  .|.|:..:|:||  
pombe   116 PYIK-WLKKRKGHAKGESTF-----------------LDNRSENQSVIV--QGQGETPSVIIT-- 158

  Rat   161 RGKDILSYLEKNISVQMTIAVGTRMPPKNFSRGSLVFVSISFIVLMIISSAWLIFYFIQKIRYTN 225
                                ...|.|    :.||..||.:|                        
pombe   159 --------------------YDVRRP----NLGSTSFVEMS------------------------ 175

  Rat   226 ARDRNQRRLGDAAKKAISKLTTRTVKKGDKETD-----PDFDHCAVCIESYKQNDVVRVLPCKHV 285
                          .|:|.:.......||...|     .:.|.|.:|...|..:|::|||||:||
pombe   176 --------------SALSNIYNTDASDGDSSDDSCLLEDEEDFCIICYADYAFDDILRVLPCEHV 226

  Rat   286 FHKSCVDPWLSE-HCTCPMCKLNILK 310
            ||..|:|.|::. ..:||:|..:..|
pombe   227 FHTQCIDTWMTTMKASCPLCNEDYYK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf130XP_038942740.1 PA_GRAIL_like 40..179 CDD:239037 15/82 (18%)
HRD1 <197..366 CDD:227568 29/120 (24%)
RING-H2_RNF130 262..310 CDD:319717 20/48 (42%)
meu34NP_593329.1 RING 205..249 CDD:238093 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm64399
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.