DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf130 and SPAP32A8.03c

DIOPT Version :9

Sequence 1:XP_038942740.1 Gene:Rnf130 / 652955 RGDID:1562041 Length:439 Species:Rattus norvegicus
Sequence 2:NP_594179.1 Gene:SPAP32A8.03c / 2542072 PomBaseID:SPAP32A8.03c Length:513 Species:Schizosaccharomyces pombe


Alignment Length:132 Identity:39/132 - (29%)
Similarity:60/132 - (45%) Gaps:22/132 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat   237 AAKKAISKLTTRTVKKGDKETDPDFDHCAVCIESYKQNDVVRVLPCKHVFHKSCVDPWLSEHCTC 301
            |.:..|:|:   .|:|..||...:...|.:|:|.:|.||.|..|||||.||::|:.|||..:.||
pombe   372 APEDVIAKM---KVQKPPKELIDEEGECTICMEMFKINDDVIQLPCKHYFHENCIKPWLRVNGTC 433

  Rat   302 PMCKLNILKALGIVPNLPCTDNVAFDMER-------------LTRTQAVNRRSALGDLANDSSLG 353
            .:|:      ..:.||....:|.:.|...             .|..|....|:...:.|:.|:|.
pombe   434 AICR------APVDPNSQQRNNTSTDSANGHNPSNHANPSTSTTNDQGATLRNESFNAASQSNLS 492

  Rat   354 LE 355
            .|
pombe   493 SE 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf130XP_038942740.1 PA_GRAIL_like 40..179 CDD:239037
HRD1 <197..366 CDD:227568 39/132 (30%)
RING-H2_RNF130 262..310 CDD:319717 21/47 (45%)
SPAP32A8.03cNP_594179.1 HypA <1..34 CDD:302785
zf-RING_2 394..437 CDD:290367 20/42 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.