DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf130 and SPBP4H10.07

DIOPT Version :9

Sequence 1:XP_038942740.1 Gene:Rnf130 / 652955 RGDID:1562041 Length:439 Species:Rattus norvegicus
Sequence 2:NP_596181.1 Gene:SPBP4H10.07 / 2541304 PomBaseID:SPBP4H10.07 Length:583 Species:Schizosaccharomyces pombe


Alignment Length:46 Identity:19/46 - (41%)
Similarity:29/46 - (63%) Gaps:2/46 - (4%)


- Green bases have known domain annotations that are detailed below.


  Rat   262 DHCAVCIESYKQNDVVRVL-PCKHVFHKSCVDPWL-SEHCTCPMCK 305
            :.|.||:.:::.||..|.| .|.|.||:.|:|.|| |...:||:|:
pombe   523 ERCLVCLSNFELNDECRRLKQCNHFFHRECIDQWLTSSQNSCPLCR 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf130XP_038942740.1 PA_GRAIL_like 40..179 CDD:239037
HRD1 <197..366 CDD:227568 19/46 (41%)
RING-H2_RNF130 262..310 CDD:319717 19/46 (41%)
SPBP4H10.07NP_596181.1 PHA03328 77..>156 CDD:223046
zf-rbx1 <522..568 CDD:289448 18/44 (41%)
RING 525..570 CDD:238093 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I3559
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.