powered by:
Protein Alignment Rnf130 and SPBC2A9.04c
DIOPT Version :9
Sequence 1: | XP_038942740.1 |
Gene: | Rnf130 / 652955 |
RGDID: | 1562041 |
Length: | 439 |
Species: | Rattus norvegicus |
Sequence 2: | NP_596213.1 |
Gene: | SPBC2A9.04c / 2540480 |
PomBaseID: | SPBC2A9.04c |
Length: | 741 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 71 |
Identity: | 23/71 - (32%) |
Similarity: | 36/71 - (50%) |
Gaps: | 12/71 - (16%) |
- Green bases have known domain annotations that are detailed below.
Rat 250 VKKGDKETDPDFD----------HCAVCIESYKQNDVVRV--LPCKHVFHKSCVDPWLSEHCTCP 302
||:..||....|: .|.:|.:...:||..:. :||.|:|.|:|:..||..|||||
pombe 83 VKRAVKEAWDSFEPLSNDQLMDLTCPICYDDMNENDEKQATKMPCGHIFGKNCLQKWLENHCTCP 147
Rat 303 MCKLNI 308
:|:..:
pombe 148 LCRKEV 153
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.