DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC5A3 and CG2187

DIOPT Version :9

Sequence 1:NP_008864.4 Gene:SLC5A3 / 6526 HGNCID:11038 Length:718 Species:Homo sapiens
Sequence 2:NP_001189331.1 Gene:CG2187 / 43743 FlyBaseID:FBgn0017448 Length:623 Species:Drosophila melanogaster


Alignment Length:584 Identity:122/584 - (20%)
Similarity:228/584 - (39%) Gaps:128/584 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    16 YFILVMCIG-------FFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGA 73
            ||:.|:.:|       :|..:..:::|...|...|:.|..:.|..||..|.:.....:.:.....
  Fly    29 YFVFVIMLGASAGIGVYFGFFSKSKNTTEEYLRGGKKMQTLPIAISLVASQLSGIAIMSIPAESY 93

Human    74 ASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGHRIQV---YFAALSLILYI 135
            ..||.........|:::.:|.::.:|::..:.|....|||..||.....|:   :|...|     
  Fly    94 TYGFNYIFVVLAMLVVIPILIYIIVPVFYENNVSNCYEYLEMRFNKRTRQLVTFFFVTNS----- 153

Human   136 FTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLM 200
            |..|.|.::..:|...:..|.|:::..:::..:....|:.||:.||::||.:|..:|::..:.:.
  Fly   154 FLMLPVYMFIPSLAFAQVTGMNIHLINVMVSSICIFYTMLGGIKAVVWTDVVQGAIMLLSVVAVG 218

Human   201 IISIMEIGGFEEVKRRYMLASPDVTSILLTYNLSNTNSCNVSPKKEALKMLRNPTDEDVPWPGFI 265
            ::..:..||...|..|    :.|.......:.|                   :|......|    
  Fly   219 VLGTIRSGGMFTVMER----ASDGGRFNFDFGL-------------------DPRIRMTFW---- 256

Human   266 LGQTPASVWYWCA----DQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFTD 326
             |.|...::.|..    :|..|||:::..:.:|||.|.:::|...|:..|...:.|:   |:|..
  Fly   257 -GATMGGIFMWTGHIGLNQSCVQRIVSLPSYSHAKKSLIVSGLGFLIISFFNTISGI---IMFAR 317

Human   327 DIACINPEHCMLVCGSRAGCSNIAYPRLVMKLVP----------VGLRGLMMAVMIAALMSDLDS 381
            ...| :|   ||     ||.  ::.|.   |::|          .|:.|:.::.:.:|.:|.|.:
  Fly   318 YYGC-DP---ML-----AGL--VSKPD---KMMPFFVQDIMGHLAGMPGVFISCVFSAALSSLSA 368

Human   382 IFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVVISIAW-VPIIVEMQGGQMYL---YIQ 442
            ..||.:.:...|..|...:...:|                 ..| :.:||.:.||...|   .:|
  Fly   369 TLNSLAGVVYFDYIKPRIRHTEAR-----------------ANWAMKLIVVVMGGYCILGGFMVQ 416

Human   443 EVADYL----------TPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFAYRAPECD 497
            .....|          |..|..:|||.:|..|||.:.|    :...::..|.::...|.     .
  Fly   417 NFNSILQTVVTITGINTGAVVGVFLLGMFVPRCNAKTA----VTSIIVSVVAMVWIIAN-----G 472

Human   498 QPDNRPGFIKDIHYMYV--------ATGLFWVTGLI--TVIVSLLTPPPTKEQIRTTTFWSKKN 551
            |.:.:.|.||   |..:        |.||:.:...|  |....:...||:...: ||.|.|.::
  Fly   473 QMNFKSGLIK---YEVLPNSLDQCEARGLYMIAEAINKTDFTPVTMKPPSGAPV-TTAFHSDRD 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC5A3NP_008864.4 SLC5sbd_SMIT 9..718 CDD:271382 122/584 (21%)
CG2187NP_001189331.1 SLC5sbd_NIS-SMVT 27..561 CDD:271383 122/584 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146408
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.