DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMTN and Ehbp1

DIOPT Version :9

Sequence 1:NP_001369571.1 Gene:SMTN / 6525 HGNCID:11126 Length:1009 Species:Homo sapiens
Sequence 2:NP_995865.2 Gene:Ehbp1 / 36912 FlyBaseID:FBgn0034180 Length:1141 Species:Drosophila melanogaster


Alignment Length:490 Identity:111/490 - (22%)
Similarity:180/490 - (36%) Gaps:107/490 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   550 SMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLL----STSSGGKSTITRV---- 606
            |.:.:||:.:|             |...:....:|.|......|    :|....:|.::.:    
  Fly   129 STQQSFTLSLK-------------PVSKKITAASLELTISCVFLREGKATDEDMQSVVSMMSVNN 180

Human   607 NSPGTLARLGSVTHVTSFSHAP-------------PSSRGGC-------SIKMEAEPAEPLAAAV 651
            |....|..|..:..:..||...             .:|..||       |:...:|...|||.:.
  Fly   181 NDVAPLDDLEDIPDLDGFSEITDNFNDFTQQLEHMTTSLNGCIDVATPQSVPSLSEDPTPLAESF 245

Human   652 -------------EAANGAEQTRVNKAPEGRSPLSAEELMTIED-EGVLDKMLDQSTDFEERKLI 702
                         ||||..:   :..|..|.|..:.|.|.|... :.|:|:...:|.|       
  Fly   246 NPLHFELDADGKREAANKLD---LPTAASGGSSGAEESLKTPNGLQHVVDQTPIKSPD------- 300

Human   703 RAALRELRQRKRDQRDKERERRLQEARGRPGEGRGNTATETTTRHSQRAADGSAVSTVTKTERLV 767
                 |::|.|:                          |...:..|:...|...:.|.|..|..|
  Fly   301 -----EVKQPKQ--------------------------TPVESLRSKTNEDFDKMVTSTPLEPNV 334

Human   768 HSND----GTRTARTTTVESSFVRRSENGSGSTMMQTKTFSSSSSSKKMGSIFDREDQASPRAGS 828
            :.:|    ..|....|..|.....|.|:....|   |||...:|::|:...   .|.|:|..|.|
  Fly   335 NKDDVKPKKKRALFFTEKEDEQDLRVESVKEDT---TKTIGDNSTTKEKPK---EESQSSKDASS 393

Human   829 LAALEKRQAEKKKELMKAQSLPKTSASQARKAMIEKLEKEGAAGSPGGPRAAVQRSTSFGVPNAN 893
            :.....::.|.:...:|....|..:...|........|..|:..|..|......:.....|...|
  Fly   394 VVVPSAKRPELQPLNLKKSYEPSQTPESAPVPASVINESIGSCFSTSGSLNNSLKPVEKIVLKEN 458

Human   894 SIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAF 958
            :..|.||:||:..|:.|.:|.:.|.::||.:||||||::|:|.||..|..:||..:...|..:.|
  Fly   459 TPGQDLLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGF 523

Human   959 SSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQE 993
            .:||: ...|::::..||..|..||...|.||:.:
  Fly   524 DAAES-LGIPRVIEPRDMNMLTVPDKLAVMTYLHQ 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMTNNP_001369571.1 Smoothelin 86..128 CDD:403640
Smoothelin 167..216 CDD:403640
Smoothelin 664..713 CDD:403640 12/49 (24%)
CH_SMTNB 894..1005 CDD:409108 37/100 (37%)
Ehbp1NP_995865.2 NT-C2 12..165 CDD:287345 8/48 (17%)
CH 460..562 CDD:237981 37/99 (37%)
DUF3585 <1027..1122 CDD:288945
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.