DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC2A3 and CG14160

DIOPT Version :9

Sequence 1:NP_008862.1 Gene:SLC2A3 / 6515 HGNCID:11007 Length:496 Species:Homo sapiens
Sequence 2:NP_648380.2 Gene:CG14160 / 39177 FlyBaseID:FBgn0036066 Length:483 Species:Drosophila melanogaster


Alignment Length:472 Identity:104/472 - (22%)
Similarity:194/472 - (41%) Gaps:93/472 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    66 SVAIFSVG-GMIGSFSV-----GLFVNRFGRRNSMLIVNLLAVTGGCFMGLC--KVAKSVE---- 118
            |.:|..|| ||..::|:     |.|:|.....|.|:...:.|..|.....|.  :|.|:|.    
  Fly    31 SASIVFVGCGMRLAWSIFDTPAGKFLNNHNTHNLMMSWFIGAAVGALLAALFVQRVTKNVAYTSS 95

Human   119 ---MLILGRLVIGL---FCGLC------------TGFVPMYIG-EISPTALRGAFGTLNQLGIVV 164
               |:|.|.|.:.|   |...|            |....:..| |::..::||...:..::.:.:
  Fly    96 GFLMIIAGILNVVLPQHFLAACYSSVSVGAAYGLTQIQALVTGSEVAHKSIRGMLLSCEKIFLWL 160

Human   165 GILVAQIF--------------GLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLIN 215
            |:.: |:|              |.|..:  ::|..::|....|.|::  .||....||| .||::
  Fly   161 GVCM-QVFYTRVWHNLRPLDTQGYEMHI--DQLHGMVLAGLGLGAVI--LALAHRLESP-LLLLH 219

Human   216 RKEEENAKQILQRLWGTQDVSQDIQEMKD----ESA----RMSQEKQVTVLE----LFRVSSYRQ 268
            ::.:....:.|:.|.| |..::.::..:|    .||    |..:|.:.:|.:    ..|:..:.:
  Fly   220 QERDMAVGETLKALHG-QSTTELVRLREDCRQLHSARDWERFVEEPEESVADWRVWARRILPFFK 283

Human   269 PIIISIVLQLSQQLSGINAVFYYST--GIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGR 331
            .:::.....|:..|| .|..|...:  |:..|...   :|....||::.   :|:..|:|:..||
  Fly   284 VLLLRCFATLAVSLS-YNRAFVVVSWHGLECDMNC---MYWLAFAGLIG---SVLGAFVVDWQGR 341

Human   332 RTLHMIGLGGMAFCSTLMTVSL--------LLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFI 388
            |.:..:.|    |.:.::.|.:        .:|.::..::.:.|..:::.......|...:|..:
  Fly   342 RKVCSLSL----FLAGVVIVMVGGVFDHLESVKRSFYDINLLVIALLMLLFEVIVAGGVAVPALV 402

Human   389 -VAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTG---FLITFLAFTFFK 449
             .||.||...:  |..:||.........:|||..:..||:...||....|   |::....|.|  
  Fly   403 YTAEAFSIAHK--ARCLAGILIVEQLLQLGLLLATFEHYITVSVFFFTIGVFSFIVGLTVFMF-- 463

Human   450 VPETRGRTFEDITRAFE 466
            :||||..|..:....|:
  Fly   464 MPETRQLTLYECLLKFK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC2A3NP_008862.1 MFS_GLUT_Class1 12..456 CDD:340989 102/460 (22%)
Important for selectivity against fructose. /evidence=ECO:0000269|PubMed:26176916 277..279 0/1 (0%)
Monosaccharide binding. /evidence=ECO:0000269|PubMed:26176916 280..286 2/5 (40%)
CG14160NP_648380.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.