DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMP3 and daw

DIOPT Version :10

Sequence 1:NP_001192.4 Gene:BMP3 / 651 HGNCID:1070 Length:472 Species:Homo sapiens
Sequence 2:NP_523461.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster


Alignment Length:121 Identity:43/121 - (35%)
Similarity:67/121 - (55%) Gaps:5/121 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   357 KKARRKQWIE----PRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHA 417
            :|:|:|:.|.    ...|.|.:|.:.|.|||||.||:.|:.::||:|.|:|......:...|:|:
  Fly   466 RKSRQKRSINCSSGMTECCREHLYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHS 530

Human   418 TIQSIVRAVGVVPGIP-EPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR 472
            :|..|:...|....:. .|||..::.|||.::..|.:....:|..|||.||||.||
  Fly   531 SIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGCR 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMP3NP_001192.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..350
TGF_beta_BMP3 363..472 CDD:381663 38/113 (34%)
dawNP_523461.1 TGF_beta_INHB 483..585 CDD:381630 37/101 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.