DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMEM135 and CG31157

DIOPT Version :9

Sequence 1:NP_075069.3 Gene:TMEM135 / 65084 HGNCID:26167 Length:458 Species:Homo sapiens
Sequence 2:NP_001097769.2 Gene:CG31157 / 318608 FlyBaseID:FBgn0051157 Length:387 Species:Drosophila melanogaster


Alignment Length:327 Identity:70/327 - (21%)
Similarity:134/327 - (40%) Gaps:56/327 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    22 SCRVSFLQITGGALEESLKIYAPLYLIAAILRKRKLD-YYLHKLLPEILQSASFLTANGALYMAF 85
            ||..:||.........|.|.|:||.|:..|:..|||. ..:..:.....|||||.....|:....
  Fly    27 SCTKAFLWNLYRNHVSSAKYYSPLLLLPLIMNWRKLSKSMVLSVAKNYAQSASFAAWINAITFYL 91

Human    86 FCILRKILGKF-YSWTPGFGAALP---ASYVAILIERKSRRGLLTIYMANL---ATETL---FRM 140
            .|:.|::..:| :.:.|    .||   ||.::.|:..:    :|..::..:   |.|:|   |.:
  Fly    92 MCMGRRLNDRFVFIFIP----FLPCWIASQLSWLMPPQ----VLHFFVTGITPAAMESLMRYFNI 148

Human   141 GVARGTITTLRNGEVLLFCITAAMYMFFFRCKDGLKGFTFSALRFIVGKEEIP--THSFSPEAAY 203
            |:....:     .:.|||.|::.:.:.:.:.:. ..||.|      :....:|  |..::   ..
  Fly   149 GLVHSPM-----AQTLLFMISSVIVLHYQQTRK-YSGFWF------IRPASLPEDTEDWT---IL 198

Human   204 AKVEQKREQHEEKPGRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNCISYCIKGFIRMFSVGYLI 268
            .:|:|...:.....|    |||....::.:.|     |..|.:.....|: :.|:|.:|.|..|:
  Fly   199 KQVQQGIRELRSYLG----IGLAMDLLNPLMK-----RNMKLWRPKMTSF-LAGYIGLFKVVQLL 253

Human   269 QCCLRIPSAFRHLFTQPSRLLSLFYNKENFQLGAFLGSFVSIYKGTSCFLRW--IRNLDDELHAI 331
                    ..:.|....:..|:.|.:..:|.|.:...:|:.....|:..:.|  :.|..||..::
  Fly   254 --------LLKRLNVNQANALASFISGSSFALLSNRLTFMCFAIVTAIQVIWSQVCNTKDEKDSV 310

Human   332 IA 333
            ::
  Fly   311 LS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TMEM135NP_075069.3 TMEM135_C_rich 9..142 CDD:292604 34/130 (26%)
Tim17 249..>338 CDD:280604 17/87 (20%)
CG31157NP_001097769.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378483at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.