DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK15 and Eip63E

DIOPT Version :9

Sequence 1:NP_001353315.1 Gene:CDK15 / 65061 HGNCID:14434 Length:435 Species:Homo sapiens
Sequence 2:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster


Alignment Length:354 Identity:213/354 - (60%)
Similarity:255/354 - (72%) Gaps:15/354 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    71 KRPRSNSDCF---QEEDLRQGFQWRKSL-------PFGAASSYLNLEKLGEGSYATVYKGISRIN 125
            |.||..|:.|   ||...|     ||..       |||...:|:.||.||||||||||||.|::.
  Fly   168 KPPRPKSEVFLNKQETHPR-----RKRFSAFGGDSPFGKQEAYVKLEPLGEGSYATVYKGFSKLT 227

Human   126 GQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEYMHTDLAQYMS 190
            .|.||||.|.:..|||.||||||||||||.|||:|||.||||:||:|||||||||::|||:|||.
  Fly   228 YQRVALKEIRLQEEEGAPFTAIREASLLKELKHSNIVTLHDIVHTRETLTFVFEYVNTDLSQYME 292

Human   191 QHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKLADFGLARAKSIPSQT 255
            :|||||...|||||:|||||||:|.|.:.|||||:||||||||..|||||||||||||||:||.|
  Fly   293 KHPGGLDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHT 357

Human   256 YSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLFPGVSNILEQLEKIWEVLGVP 320
            ||.|||||||||||.|||:||||:.||:||.||||:||..|.|.|||:.:..:||:||:::||.|
  Fly   358 YSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTP 422

Human   321 TEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHD 385
            ||||||||:..|.|.|.......||.|...:.||..:.|.|.:|:..|:..|..|:.|.:||.|.
  Fly   423 TEDTWPGVTHFPGYKPHKLGFYRPRKLGHNFPRLYDIIEGETIANGFLQLNPEQRLGADDALQHP 487

Human   386 YFSALPSQLYQLPDEESLFTVSGVRLKPE 414
            ||:.||.:||:||||.|:|||.||:|..|
  Fly   488 YFAQLPKKLYELPDETSIFTVEGVQLYTE 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK15NP_001353315.1 STKc_PFTAIRE2 102..387 CDD:270852 182/284 (64%)
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 184/288 (64%)
STKc_PCTAIRE_like 204..489 CDD:270835 182/284 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 406 1.000 Domainoid score I708
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S747
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0003670
OrthoInspector 1 1.000 - - otm41673
orthoMCL 1 0.900 - - OOG6_107080
Panther 1 1.100 - - LDO PTHR24056
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3201
SonicParanoid 1 1.000 - - X2541
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.