DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Megf6 and NimB2

DIOPT Version :9

Sequence 1:NP_075244.1 Gene:Megf6 / 65049 RGDID:621188 Length:1574 Species:Rattus norvegicus
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:392 Identity:102/392 - (26%)
Similarity:128/392 - (32%) Gaps:146/392 - (37%)


- Green bases have known domain annotations that are detailed below.


  Rat  1094 SCLHGGIC--------------DRLTGHCLCPAGWTGD--KCQSSCVSGTFGVH----CEEHCA- 1137
            |.:..|:|              |:..|:     |.|.|  :.|..|.......|    ||..|| 
  Fly   128 SAMASGVCYKEVPTASLLRNSRDQFVGN-----GTTPDMSRIQVCCDGYERNPHIYRRCEPICAD 187

  Rat  1138 -CRKGASCHHVTGACFCPPGWRGPH-------CEQACPRGWFGEACAQRCLCPTNASCHHVTGEC 1194
             ||.|...  ....|.|.||    |       |...||.|.....|.:|             .||
  Fly   188 DCRNGICT--APNTCVCIPG----HVRTAEGKCISTCPLGCGNGVCDER-------------NEC 233

  Rat  1195 RCPPGF-----TGLSCEQACQPG-TFGKDCEHLCQCPGETWACDPASGVCTCAAGYHGTGCLQRC 1253
            :|..|:     |...|:..|:|| :||:     |..|.:          |.|..||      :..
  Fly   234 KCREGYSLEPETRKYCQPECKPGCSFGR-----CVAPNK----------CACLDGY------RLA 277

  Rat  1254 PSGRYGPGCEHICKCLNGGTCDPATGACYCPAGFLGAD------CSLACPQGR-FGPSCAHVCAC 1311
            ..|    .||.:|.....|.| .|.|.|.|.||:|...      ||:.|..|| .||.   :|.|
  Fly   278 ADG----SCEPVCDSCENGKC-TAPGHCNCNAGYLKLQGRCEPICSIPCKNGRCIGPD---ICEC 334

  Rat  1312 RQGAACDPVSGACICSPGKTGVRCEHGCPQDRFGKGCELKCACRNGGLCHATNGSCSCPLGWMGP 1376
            ..|...|..|..|:              |:      |:|.|.   .|:| ..|..|.|..|::..
  Fly   335 ASGFEWDRKSAECL--------------PK------CDLPCL---NGVC-VGNNQCDCKTGYVRD 375

  Rat  1377 H-----CEHACPAGRYGAACLLECFCQNNGSCEPTTGACLCGPGFYGQACEHSCPSGFHG-PGCQ 1435
            .     |:..||.|           || ||.|. ....|:|.|||        ..||..| ..||
  Fly   376 EHQRNICQPHCPQG-----------CQ-NGYCS-APNFCICRPGF--------IKSGIKGRQTCQ 419

  Rat  1436 RV 1437
            .|
  Fly   420 AV 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Megf6NP_075244.1 EMI 42..112 CDD:284877
FXa_inhibition 127..162 CDD:291342
vWFA <154..202 CDD:294047
vWFA <237..285 CDD:294047
vWFA <284..325 CDD:294047
FXa_inhibition 338..373 CDD:291342
vWFA <371..410 CDD:294047
vWFA <413..452 CDD:294047
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1555..1574
NimB2NP_723857.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.