DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PINK1 and MEK1

DIOPT Version :9

Sequence 1:NP_115785.1 Gene:PINK1 / 65018 HGNCID:14581 Length:581 Species:Homo sapiens
Sequence 2:NP_014996.3 Gene:MEK1 / 854533 SGDID:S000005878 Length:497 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:75/291 - (25%)
Similarity:120/291 - (41%) Gaps:83/291 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   271 HPNIIRVLRAFTSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLFLVMKNYPCTLRQYL----CV 331
            |||||:|...|...    ...|..:.|::|          |..||           .||    |:
Yeast   220 HPNIIKVYHTFCDR----NNHLYIFQDLIP----------GGDLF-----------SYLAKGDCL 259

Human   332 NTPSPRLAAMMLLQLLEGVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGL 396
            .:.|...:.:::.|:|:.:::|..|.|.|||||.||||: ..|:.|..:|:||||..        
Yeast   260 TSMSETESLLIVFQILQALNYLHDQDIVHRDLKLDNILL-CTPEPCTRIVLADFGIA-------- 315

Human   397 QLPFSSWYVDRGGNGCLM----------APEVSTARPGPRAVIDYSKA------------DAWAV 439
                    .|...|...|          ||||. .|...:|...:|:|            |.|::
Yeast   316 --------KDLNSNKERMHTVVGTPEYCAPEVG-FRANRKAYQSFSRAATLEQRGYDSKCDLWSL 371

Human   440 GAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALP------ESVPPDVRQLVRALLQREASKRP 498
            |.|.:.:...::||||.|.   |....|.|::..|.      :.|..:.:..|:.|||.:..||.
Yeast   372 GVITHIMLTGISPFYGDGS---ERSIIQNAKIGKLNFKLKQWDIVSDNAKSFVKDLLQTDVVKRL 433

Human   499 SARVAANVLHLSLW-GEHILALKNLKLDKMV 528
            :::  ..:.|  :| .:|:..|:.|...|::
Yeast   434 NSK--QGLKH--IWIAKHLSQLERLYYKKIL 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PINK1NP_115785.1 Required for outer membrane localization. /evidence=ECO:0000269|PubMed:30733118 111..117
STKc_PINK1 162..512 CDD:270920 70/272 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..208
MEK1NP_014996.3 FHA 28..122 CDD:238017
STKc_CAMK 160..443 CDD:270687 70/272 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4469
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.