DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PINK1 and Pink1

DIOPT Version :9

Sequence 1:NP_115785.1 Gene:PINK1 / 65018 HGNCID:14581 Length:581 Species:Homo sapiens
Sequence 2:NP_001100164.1 Gene:Pink1 / 298575 RGDID:1305769 Length:257 Species:Rattus norvegicus


Alignment Length:241 Identity:189/241 - (78%)
Similarity:204/241 - (84%) Gaps:1/241 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPN 65
            |||||||||||||||||||||..|||...|.|:|||.|...||||||..:.|||:||.:||.||:
  Rat     1 MAVRQALGRGLQLGRALLLRFAPKPGPVSGWGKPGPGAAWGRGERPGRVSSPGAQPRPLGLPLPD 65

Human    66 RLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQA 130
            |.|||||||||||||:||||||||.|.|||||||||||||||||||||||||||||.||||||||
  Rat    66 RYRFFRQSVAGLAARIQRQFVVRARGGAGPCGRAVFLAFGLGLGLIEEKQAESRRAASACQEIQA 130

Human   131 IFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRG 195
            |||||:|...|||||||.||||||:|||||:|||||:|||||||||||||:||..|..||| |:|
  Rat   131 IFTQKNKQVSDPLDTRRWQGFRLEDYLIGQAIGKGCNAAVYEATMPTLPQHLEKAKHLGLL-GKG 194

Human   196 PGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQEL 241
            |...:.|...|:||||||||.||||||||||||||||||:.|||||
  Rat   195 PDVVSKGADGEQAPGAPAFPFAIKMMWNISAGSSSEAILSKMSQEL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PINK1NP_115785.1 Required for outer membrane localization. /evidence=ECO:0000269|PubMed:30733118 111..117 5/5 (100%)
STKc_PINK1 162..512 CDD:270920 60/80 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..208 8/18 (44%)
Pink1NP_001100164.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..60 17/31 (55%)
Required for outer membrane localization. /evidence=ECO:0000250|UniProtKB:Q9BXM7 111..117 5/5 (100%)
PKc_like 162..>240 CDD:304357 58/78 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83682070
Domainoid 1 1.000 411 1.000 Domainoid score I10397
eggNOG 1 0.900 - - E1_KOG4158
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32672
Inparanoid 1 1.050 942 1.000 Inparanoid score I5947
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG41021
OrthoDB 1 1.010 - - D124353at32523
OrthoFinder 1 1.000 - - FOG0008271
OrthoInspector 1 1.000 - - oto130720
orthoMCL 1 0.900 - - OOG6_109238
Panther 1 1.100 - - LDO PTHR22972
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X7349
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1717.310

Return to query results.
Submit another query.