DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PINK1 and prag1

DIOPT Version :9

Sequence 1:NP_115785.1 Gene:PINK1 / 65018 HGNCID:14581 Length:581 Species:Homo sapiens
Sequence 2:XP_002936500.1 Gene:prag1 / 100486686 XenbaseID:XB-GENE-5933625 Length:1294 Species:Xenopus tropicalis


Alignment Length:289 Identity:72/289 - (24%)
Similarity:114/289 - (39%) Gaps:80/289 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   268 LAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLPSRLHPEGLGHG----------------RTLFL 316
            |..|.||.:....|.::||             .|.|||..:..|                ..:.:
 Frog   968 LPVHFNIQQDCGNFVATVP-------------SSMLHPPNIPKGPSSNESSQTVGPASEQECVVV 1019

Human   317 VMKNYP-CTLRQYL----CVNTPSP----RLAAMMLLQLLEGVDHLVQQGIAHRDLKSDNILV-- 370
            :.:..| .|..:::    ..:...|    |...::||||..|::||.:.||.||||..:|:|:  
 Frog  1020 ITREVPYLTAAEFVEESGSTHQLQPEVYERQVCLLLLQLCNGLEHLKEHGIIHRDLCLENLLLVH 1084

Human   371 -ELDPDG------CPWLVIADF-------GCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTA 421
             :..|:.      .|.|::::|       ||   :||...:            :...:|||:..|
 Frog  1085 WQNSPEKIKDVKYVPRLIVSNFSKAKQRSGC---EESKPRR------------DKTRLAPEIMAA 1134

Human   422 RPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPE-SV-PPDVRQ 484
            .       .|.|.|.:..|.:.||:....|||  :.:|.|....|.:..||:||. || ...::.
 Frog  1135 S-------QYKKFDEFQTGILIYELLHQPNPF--EVRASLHEHDYSQKDLPSLPALSVYSRGLQH 1190

Human   485 LVRALLQREASKRPSARVAANVLHLSLWG 513
            |...||:.:..||.....|..||...|||
 Frog  1191 LAHLLLEADPIKRIRISEAKRVLQCLLWG 1219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PINK1NP_115785.1 Required for outer membrane localization. /evidence=ECO:0000269|PubMed:30733118 111..117
STKc_PINK1 162..512 CDD:270920 69/286 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..208
prag1XP_002936500.1 PKc_like <1061..1218 CDD:389743 49/180 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.