DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SKP1 and SkpA

DIOPT Version :9

Sequence 1:NP_733779.1 Gene:SKP1 / 6500 HGNCID:10899 Length:163 Species:Homo sapiens
Sequence 2:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster


Alignment Length:163 Identity:125/163 - (76%)
Similarity:142/163 - (87%) Gaps:1/163 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHH 65
            ||||||||||.|||:.|::|||.|.||||||||.||:|: ::..|||||||:.||:||:.|..:|
  Fly     1 MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDD-ENAIVPLPNVNSTILRKVLTWAHYH 64

Human    66 KDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130
            ||||.|.||||:||||||||..||.:|||||||||||||||||||||||||::||||||||||||
  Fly    65 KDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGK 129

Human   131 TPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163
            ||||||||||||.||:..||.||||||:|||||
  Fly   130 TPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SKP1NP_733779.1 BTB_POZ_SKP1 4..127 CDD:349631 90/122 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..83 14/19 (74%)
Interaction with the F-box domain of F-box proteins. /evidence=ECO:0000250 104..163 50/58 (86%)
Skp1 113..160 CDD:396171 38/46 (83%)
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 90/122 (74%)
Skp1 112..159 CDD:396171 38/46 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149267
Domainoid 1 1.000 89 1.000 Domainoid score I7869
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38775
Inparanoid 1 1.050 255 1.000 Inparanoid score I3180
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm41331
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - LDO PTHR11165
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1343
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.